Bioactive grade

Recombinant human TNF Receptor I protein (Fc Chimera Active) (ab174046)

Description

  • Product name

    Recombinant human TNF Receptor I protein (Fc Chimera Active)
    See all TNF Receptor I proteins and peptides
  • Biological activity

    Immobilized Human TNF-alpha (Cat. No. ab155699) at 5 µg/mL (100 µl/well) can bind Human TNFR1, Fc Tag (Cat. No. ab174046) with a linear range of 0.04-1.2 ng/mL.

  • Purity

    > 98 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      IYPSGVIGLVPHLGDREKRDSVCPQGKYIHPQNNSICCTKCHKGTYLYND CPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDR DTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAG FFLRENECVSCSNCKKSLECTKLCLPQIENVKGTEDSGTT
    • Predicted molecular weight

      48 kDa
    • Amino acids

      22 to 211
    • Additional sequence information

      Soluble TNF Receptor I Fc Chimera, fused with Fc fragment of Human IgG1 at the C-terminus. (NP_001056)

Specifications

Our Abpromise guarantee covers the use of ab174046 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

    ELISA

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at 4°C prior to reconstitution. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.00
    Constituents: 5% Trehalose, 0.61% Tris, 0.75% Glycine

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized protein in 100 µl sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage. After reconstitution store under sterile conditions for 1 month at 4°C - 8°C or 3 months at -20°C to -80°C.

General Info

  • Alternative names

    • CD120a
    • FPF
    • MGC19588
    • p55
    • p55-R
    • p60
    • TBP1
    • TBPI
    • TNF R
    • TNF R55
    • TNF-R1
    • TNF-RI
    • TNFAR
    • TNFR-I
    • TNFR1
    • TNFR55
    • TNFR60
    • TNFRI
    • TNFRSF1a
    • TNR1A_HUMAN
    • Tumor necrosis factor receptor 1
    • Tumor necrosis factor receptor superfamily, member 1A
    • Tumor necrosis factor receptor type 1
    • Tumor necrosis factor receptor type I
    • Tumor necrosis factor-binding protein 1
    see all
  • Function

    Receptor for TNFSF2/TNF-alpha and homotrimeric TNFSF1/lymphotoxin-alpha. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis. Contributes to the induction of non-cytocidal TNF effects including anti-viral state and activation of the acid sphingomyelinase.
  • Involvement in disease

    Familial hibernian fever
    Multiple sclerosis 5
  • Sequence similarities

    Contains 1 death domain.
    Contains 4 TNFR-Cys repeats.
  • Domain

    The domain that induces A-SMASE is probably identical to the death domain. The N-SMASE activation domain (NSD) is both necessary and sufficient for activation of N-SMASE.
    Both the cytoplasmic membrane-proximal region and the C-terminal region containing the death domain are involved in the interaction with TRPC4AP.
  • Post-translational
    modifications

    The soluble form is produced from the membrane form by proteolytic processing.
  • Cellular localization

    Cell membrane. Golgi apparatus membrane. Secreted. A secreted form is produced through proteolytic processing and Secreted. Lacks a Golgi-retention motif, is not membrane bound and therefore is secreted.
  • Information by UniProt

Images

  • Immobilized Human TNF-alpha (Tag Free) low endotoxin at 2 µg/mL (100 µL/well) can bind Human TNFR1 (Fc Tag) with a linear range of 0.2-6 ng/mL (QC tested).
  • SDS-PAGE analysis ofab174046 in reducing conditions. Gel stained overnight with Coomassie Blue. DTT-reduced Protein migrates as 50-60 kDa due to different glycosylation.

  • Immobilized Human TNF-alpha (Cat. No. ab155699) at 5 µg/mL (100 µl/well) can bind Human TNFR1, Fc Tag (Cat. No. ab174046) with a linear range of 0.04-1.2 ng/mL.

References

ab174046 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab174046.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up