Description

  • Product name

    Recombinant Human TNF Receptor II protein
    See all TNF Receptor II proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    ab207800 was expressed in insect cell and purified by using conventional chromatography techniques.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Insect cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      LPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSD TVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRP GWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNT TSSTDICRPHQICNVVAIPGNASMDAVCTSTSPTRSMAPGAVHLPQPVST RSQHTQPTPEPSTAPSTSFLLPMGPSPPAEGSTGDHHHHHH
    • Predicted molecular weight

      26 kDa including tags
    • Amino acids

      23 to 257
    • Tags

      His tag C-Terminus
    • Additional sequence information

      NP_001057.

Specifications

Our Abpromise guarantee covers the use of ab206800 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 90% PBS, 10% Glycerol

General Info

  • Alternative names

    • CD120b
    • p75
    • p75 TNF receptor
    • p75TNFR
    • p80 TNF alpha receptor
    • p80 TNF-alpha receptor
    • Soluble TNFR1B variant 1
    • TBP-2
    • TBPII
    • TNF R II
    • TNF R2
    • TNF R75
    • TNF-R2
    • TNF-RII
    • TNFBR
    • TNFR-II
    • TNFR1B
    • TNFR2
    • TNFR80
    • TNFRII
    • Tnfrsf1b
    • TNR1B_HUMAN
    • Tumor necrosis factor beta receptor
    • Tumor necrosis factor binding protein 2
    • Tumor necrosis factor receptor 2
    • Tumor necrosis factor receptor superfamily member 1B
    • Tumor necrosis factor receptor type II
    • Tumor necrosis factor-binding protein 2
    see all
  • Function

    Receptor with high affinity for TNFSF2/TNF-alpha and approximately 5-fold lower affinity for homotrimeric TNFSF1/lymphotoxin-alpha. The TRAF1/TRAF2 complex recruits the apoptotic suppressors BIRC2 and BIRC3 to TNFRSF1B/TNFR2. This receptor mediates most of the metabolic effects of TNF-alpha. Isoform 2 blocks TNF-alpha-induced apoptosis, which suggests that it regulates TNF-alpha function by antagonizing its biological activity.
  • Sequence similarities

    Contains 4 TNFR-Cys repeats.
  • Post-translational
    modifications

    Phosphorylated; mainly on serine residues and with a very low level on threonine residues.
    A soluble form (tumor necrosis factor binding protein 2) is produced from the membrane form by proteolytic processing.
  • Cellular localization

    Secreted and Cell membrane.
  • Information by UniProt

Images

  • SDS-PAGE analysis using ab206800 at 3 µg.

References

ab206800 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab206800.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up