Bioactive grade

Recombinant human TNF Receptor II protein (Active) (ab235709)

Description

  • Product name

    Recombinant human TNF Receptor II protein (Active)
    See all TNF Receptor II proteins and peptides
  • Biological activity

    Fully biologically active when compared to standard. The ED50 as determined by its ability to inhibit the TNF-α mediated cytotoxicity in the L-929 cells is less than 0.2 μg/ml, corresponding to a specific activity of >5000 IU/mg in the presence of 0.25 ng/ml of rHuTNF-α.

  • Purity

    > 97 % SDS-PAGE.
    > 97 % HPLC.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSD TVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRP GWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNT TSSTDICRPHQICNVVAIPGNASMDAVCTSTSPT
    • Predicted molecular weight

      20 kDa
    • Amino acids

      23 to 206

Specifications

Our Abpromise guarantee covers the use of ab235709 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

    HPLC

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituent: PBS

    Lyophilised from 0.2 µm filtered solution.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at = -20 °C. Further dilutions should be made in appropriate buffered solutions.

General Info

  • Alternative names

    • CD120b
    • p75
    • p75 TNF receptor
    • p75TNFR
    • p80 TNF alpha receptor
    • p80 TNF-alpha receptor
    • Soluble TNFR1B variant 1
    • TBP-2
    • TBPII
    • TNF R II
    • TNF R2
    • TNF R75
    • TNF-R2
    • TNF-RII
    • TNFBR
    • TNFR-II
    • TNFR1B
    • TNFR2
    • TNFR80
    • TNFRII
    • Tnfrsf1b
    • TNR1B_HUMAN
    • Tumor necrosis factor beta receptor
    • Tumor necrosis factor binding protein 2
    • Tumor necrosis factor receptor 2
    • Tumor necrosis factor receptor superfamily member 1B
    • Tumor necrosis factor receptor type II
    • Tumor necrosis factor-binding protein 2
    see all
  • Function

    Receptor with high affinity for TNFSF2/TNF-alpha and approximately 5-fold lower affinity for homotrimeric TNFSF1/lymphotoxin-alpha. The TRAF1/TRAF2 complex recruits the apoptotic suppressors BIRC2 and BIRC3 to TNFRSF1B/TNFR2. This receptor mediates most of the metabolic effects of TNF-alpha. Isoform 2 blocks TNF-alpha-induced apoptosis, which suggests that it regulates TNF-alpha function by antagonizing its biological activity.
  • Sequence similarities

    Contains 4 TNFR-Cys repeats.
  • Post-translational
    modifications

    Phosphorylated; mainly on serine residues and with a very low level on threonine residues.
    A soluble form (tumor necrosis factor binding protein 2) is produced from the membrane form by proteolytic processing.
  • Cellular localization

    Secreted and Cell membrane.
  • Information by UniProt

Images

  • ab235709 analyzed by SDS-PAGE.

References

ab235709 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235709.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up