Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MAEQVLPQALYLSNMRKAVKIRERTPEDIFKPTNGIIHHFKTMHRYTLEM FRTCQFCPQFREIIHKALIDRNIQATLESQKKLNWCREVRKLVALKTNGD GNCLMHATSQYMWGVQDTDLVLRKALFSTLKETDTRNFKFRWQLESLKSQ EFVETGLCYDTRNWNDEWDNLIKMASTDTPMARSGLQYNSLEEIHIFVLC NILRRPIIVISGEMPADHGSVLKCFQPYALAPGENHTAKVQVTEFNGI
    • Molecular weight

      55 kDa including tags
    • Amino acids

      1 to 248

Specifications

Our Abpromise guarantee covers the use of ab132088 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • A20
    • AISBL
    • MGC104522
    • MGC138687
    • MGC138688
    • OTU domain containing protein 7C
    • OTU domain-containing protein 7C
    • OTUD7C
    • Putative DNA binding protein A20
    • Putative DNA-binding protein A20
    • TNAP3_HUMAN
    • TNF alpha-induced protein 3
    • TNFA1P2
    • TNFAIP 3
    • TNFAIP3
    • TNFAIP3 (A20)
    • Tumor necrosis factor alpha induced protein 3
    • Tumor necrosis factor alpha-induced protein 3
    • Tumor necrosis factor induced protein 3
    • Tumor necrosis factor inducible protein A20
    • tumor necrosis factor, alpha-induced protein 3
    • Zinc finger protein A20
    see all
  • Function

    Ubiquitin-editing enzyme that contains both ubiquitin ligase and deubiquitinase activities. Essential component of a ubiquitin-editing protein complex, comprising also RNF11, ITCH and TAX1BP1, that ensures the transient nature of inflammatory signaling pathways. Upon TNF stimulation, deubiquitinates 'Lys-63'-polyubiquitin chains on RIPK1 and catalyzes the formation of 'Lys-48'-polyubiquitin chains. This leads to RIPK1 proteasomal degradation and consequently termination of the TNF- or LPS-mediated activation of NF-kappa-B. In vitro able to deubiquitinate both 'Lys-48'- and 'Lys-63' polyubiquitin chains. Inhibitor of programmed cell death. Has a role in the function of the lymphoid system.
  • Sequence similarities

    Belongs to the peptidase C64 family.
    Contains 7 A20-type zinc fingers.
    Contains 1 OTU domain.
  • Domain

    The A20-type zinc fingers mediate the ubiquitin ligase activity.
    The OTU domain mediates the deubiquitinase activity.
  • Cellular localization

    Cytoplasm. Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab132088 at approximately 55.3 kDa.

References

ab132088 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132088.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up