Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MHSEAEESKEVATDVFNSKNLAVQAQKKILGKMVSKSIATTLIDDTSSEV LDELYRVTREYTQNKKEAEKIIKNLIKTVIKLAILYRNNQFNQDELALME KFKKKVHQLAMTVVSFHQVDYTFDRNVLSRLLNECREMLHQIIQRHLTAK SHGRVNNVFDHFSDCEFLAALYNPFGNFKPHLQKLCDGINKMLDEENI
    • Amino acids
      1 to 198
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161798 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • GG2 1
    • Head and neck tumor and metastasis-related protein
    • MDC-3.13
    • NDED
    • NF-kappa-B-inducible DED-containing protein
    • SCC S2
    • SCC-S2
    • SCCS2
    • TFIP8_HUMAN
    • TNF alpha-induced protein 8
    • TNF induced protein
    • TNF-induced protein GG2-1
    • TNFAIP 8
    • TNFAIP8
    • Tumor necrosis factor alpha induced protein 8
    • Tumor necrosis factor alpha-induced protein 8
    see all
  • Function
    Acts as a negative mediator of apoptosis and may play a role in tumor progression. Suppresses the TNF-mediated apoptosis by inhibiting caspase-8 activity but not the processing of procaspase-8, subsequently resulting in inhibition of BID cleavage and caspase-3 activation.
  • Tissue specificity
    Expressed at high levels in the spleen, lymph node, thymus, thyroid, bone marrow and placenta. Expressed at high levels both in various tumor tissues, unstimulated and cytokine-activated cultured cells. Expressed at low levels in the spinal cord, ovary, lung, adrenal glands, heart, brain, testis and skeletal muscle.
  • Sequence similarities
    Belongs to the TNFAIP8 family.
  • Developmental stage
    Expressed at high levels in the fetal liver, lung and kidney.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • ab161798 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161798 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161798.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up