Overview

Description

  • Nature

    Recombinant
  • Source

    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      PALPSCKEDEYPVGSECCPKCSPGYRVKEACGELTGTVCEPCPPGTYIAH LNGLSKCLQCQMCDPAMGLRASRNCSRTENAVCGCSPGHFCIVQDGDHCA ACRAYATSSPGQRVQKGGTESQDTLCQNCPPGTFSPNGTLEECQHQTKCS WLVTKAGAGTSSSHWVIEGRMDPKSCDKTHTCPPCPAPELLGGPSVFLFP PKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREE QYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPR EPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTT PPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS PGKGGGLNDIFEAQKIEWHE
    • Molecular weight

      46 kDa including tags
    • Amino acids

      37 to 202
    • Additional sequence information

      Fused to Human IgG1 Fc, with C-terminal Avi-tagTM
  • Conjugation

    Biotin

Specifications

Our Abpromise guarantee covers the use of ab198632 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    BTLA:TNFRSF14/HVEM binding activity

  • Applications

    SDS-PAGE

    Functional Studies

  • Endotoxin level

    < 1.000 Eu/µg
  • Form

    Liquid
  • Additional notes

     This product was previously labelled as TNFRSF14

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.63% Tris HCl, 0.64% Sodium chloride, 0.017% Potassium chloride, 20% Glycerol

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • HVEML
    • ATAR
    • CD270
    • CD40 like protein precursor
    • Herpes virus entry mediator A
    • Herpesvirus entry mediator
    • Herpesvirus entry mediator A
    • Herpesvirus entry mediator ligand
    • HveA
    • HVEM
    • HVEM L
    • LIGHT
    • LIGHTR
    • TNFRSF14
    • TNFSF 14
    • TNR14_HUMAN
    • TR2
    • Tumor necrosis factor receptor like gene2
    • Tumor necrosis factor receptor superfamily member 14
    • Tumor necrosis factor receptor superfamily member 14 precursor
    • Tumor necrosis factor receptor-like 2
    see all
  • Function

    Receptor for BTLA. Receptor for TNFSF14/LIGHT and homotrimeric TNFSF1/lymphotoxin-alpha. Involved in lymphocyte activation. Plays an important role in HSV pathogenesis because it enhanced the entry of several wild-type HSV strains of both serotypes into CHO cells, and mediated HSV entry into activated human T-cells.
  • Tissue specificity

    Widely expressed, with the highest expression in lung, spleen and thymus.
  • Sequence similarities

    Contains 3 TNFR-Cys repeats.
  • Post-translational
    modifications

    N-glycosylated.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • 4-20% SDS-PAGE with Coomassie stain

    Lane 1: 2 µg ab198632
    Lane 2: Protein marker

  • BTLA:TNFRSF14/HVEM binding activity, measured using an Inhibitor Screening Assay Kit.

References

ab198632 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab198632.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up