Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MKPSLLCRPLSCFLMLLPWPLATLTSTTLWQCPPGEEPDLDPGQGTLCRP CPPGTFSAAWGSSPCQPHARCSLWRRLEAQVGMATRDTLCGDCWPGWFGP WGVPRVPCQPCSWAPLGTHGCDEWGRRARRGVEVAAGASSGGETRQPGNG TRAGGPEETAAQYAVIAIVPVFCLMGLLGILVCNLLKRKGYHCTAHKEVG TGPGGGGSGINPAYRTEDANEDTIGVLVRLITEKKENAAALEELLKEYHS KQLVQTSHRPVSKLPPAPPNVPHICPHRHHLHTVQGLASLSGPCCSRCSQ KKWPEVLLSPEAVAATTPVPSLLPNPTRVPKAGAKAGRQGEITILSVGRF RVARIPEQRTSSMVSEVKTITEAGPSWGDLPDSPQPGLPPEQQALLGSGG SRTKWLKPPAENKAEENRYVVRLSESNLVI
    • Amino acids
      1 to 430
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164713 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Receptor expressed in lymphoid tissues
    • Relt
    • TNFRSF19L
    • TR19L_HUMAN
    • Tumor necrosis factor receptor superfamily member 19L
    see all
  • Function
    Mediates activation of NF-kappa-B. May play a role in T-cell activation.
  • Tissue specificity
    Highest levels are in spleen, lymph node, thymus, peripheral blood leukocytes, bone marrow and fetal liver. Very low levels in skeletal muscle, testis and colon. Not detected in brain, kidney and pancreas.
  • Sequence similarities
    Belongs to the RELT family.
    Contains 1 TNFR-Cys repeat.
  • Post-translational
    modifications
    Phosphorylated in vitro by OXSR1.
  • Cellular localization
    Cell membrane. Cytoplasm.
  • Information by UniProt

Images

  • ab164713 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164713 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164713.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up