Description

  • Product name

    Recombinant Human TNFRSF19L protein
  • Purity

    > 95 % SDS-PAGE.
    determined by SEC-HPLC and reducing SDS-PAGE.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      STTLWQCPPGEEPDLDPGQGTLCRPCPPGTFSAAWGSSPCQPHARCSLWR RLEAQVGMATRDTLCGDCWPGWFGPWGVPRVPCQPCSWAPLGTHGCDEWG RRARRGVEVAAGASSGGETRQPGNGTRAGGPEETAVDDIEGRMDEPKSCD KTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDP EVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKC KVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKG FYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGN VFSCSVMHEALHNHYTQKSLSLSPGK
    • Predicted molecular weight

      41 kDa including tags
    • Amino acids

      26 to 160
    • Additional sequence information

      Extracellular domain, fused with a FC tag at the C-terminus.

Specifications

Our Abpromise guarantee covers the use of ab191989 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 1.19% HEPES, 0.87% Sodium chloride, 10% Glycerol, 0.03% DTT

General Info

  • Alternative names

    • Receptor expressed in lymphoid tissues
    • Relt
    • TNFRSF19L
    • TR19L_HUMAN
    • Tumor necrosis factor receptor superfamily member 19L
    see all
  • Function

    Mediates activation of NF-kappa-B. May play a role in T-cell activation.
  • Tissue specificity

    Highest levels are in spleen, lymph node, thymus, peripheral blood leukocytes, bone marrow and fetal liver. Very low levels in skeletal muscle, testis and colon. Not detected in brain, kidney and pancreas.
  • Sequence similarities

    Belongs to the RELT family.
    Contains 1 TNFR-Cys repeat.
  • Post-translational
    modifications

    Phosphorylated in vitro by OXSR1.
  • Cellular localization

    Cell membrane. Cytoplasm.
  • Information by UniProt

References

ab191989 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab191989.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up