Description

  • Product name

    Recombinant Human TNFSF18/GITRL protein
    See all TNFSF18/GITRL proteins and peptides
  • Purity

    > 85 % SDS-PAGE.
    ab202190 was purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MQLETAKEPCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIY GQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTI DLIFNSEHQVLKNNTYWGIILIANPQEISLEHHHHHH
    • Predicted molecular weight

      16 kDa including tags
    • Amino acids

      70 to 199
    • Tags

      His tag C-Terminus
    • Additional sequence information

      NP_005083.

Specifications

Our Abpromise guarantee covers the use of ab202190 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 10% Glycerol, 0.32% Tris HCl

General Info

  • Alternative names

    • Activation inducible TNF related ligand
    • Activation-inducible TNF-related ligand
    • AITR ligand
    • AITRL
    • GITR ligand
    • GITRL
    • Glucocorticoid induced TNF related ligand
    • Glucocorticoid induced TNFR related protein ligand
    • Glucocorticoid-induced TNF-related ligand
    • hGITRL
    • MGC138237
    • TL6
    • TNF18_HUMAN
    • TNFSF18
    • TNLG2A
    • Tumor necrosis factor (ligand) superfamily member 18
    • Tumor necrosis factor ligand 2A
    • Tumor necrosis factor ligand superfamily member 18
    see all
  • Function

    Cytokine that binds to TNFRSF18/AITR/GITR. Important for interactions between activated T-lymphocytes and endothelial cells and may modulate T-lymphocyte survival in peripheral tissues.
  • Tissue specificity

    Expressed at high levels in the small intestine, ovary, testis, kidney and endothelial cells.
  • Sequence similarities

    Belongs to the tumor necrosis factor family.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab202190 (3 μg).

References

ab202190 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab202190.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up