Description

  • Product name

    Recombinant human TNFSF18/GITRL protein (Active)
    See all TNFSF18/GITRL proteins and peptides
  • Biological activity

    Fully biologically active when compared to standard. The biological activity as determined by stimulation of IL-8 production using human PBMC is in a concentration range of 0.1-10 ng/ml.

  • Purity

    > 95 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      ETAKEPCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQV APNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYE LHVGDTIDLI FNSEHQVLKN NTYWGIILLA NPQFIS
    • Predicted molecular weight

      14 kDa
    • Amino acids

      74 to 199

Associated products

Specifications

Our Abpromise guarantee covers the use of ab235717 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at = -20 °C. Further dilutions should be made in appropriate buffered solutions.

General Info

  • Alternative names

    • Activation inducible TNF related ligand
    • Activation-inducible TNF-related ligand
    • AITR ligand
    • AITRL
    • GITR ligand
    • GITRL
    • Glucocorticoid induced TNF related ligand
    • Glucocorticoid induced TNFR related protein ligand
    • Glucocorticoid-induced TNF-related ligand
    • hGITRL
    • MGC138237
    • TL6
    • TNF18_HUMAN
    • TNFSF18
    • TNLG2A
    • Tumor necrosis factor (ligand) superfamily member 18
    • Tumor necrosis factor ligand 2A
    • Tumor necrosis factor ligand superfamily member 18
    see all
  • Function

    Cytokine that binds to TNFRSF18/AITR/GITR. Important for interactions between activated T-lymphocytes and endothelial cells and may modulate T-lymphocyte survival in peripheral tissues.
  • Tissue specificity

    Expressed at high levels in the small intestine, ovary, testis, kidney and endothelial cells.
  • Sequence similarities

    Belongs to the tumor necrosis factor family.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • SDS-PAGE analysis of recombinant human TNFSF18/GITRL protein (Active) (ab235717).

References

ab235717 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235717.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up