Description

  • Product name

    Recombinant Human TNFSF18/GITRL protein (Tagged-His Tag)
    See all TNFSF18/GITRL proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    Purity of ab196127 is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      ETAKEPCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQV APNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLI FNSEHQVLKNNTYWGIILLANPQFISVDHHHHHH
    • Predicted molecular weight

      15 kDa including tags
    • Amino acids

      74 to 199
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab196127 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituent: 100% PBS

    Lyophilized from a 0.2 µm filtered solution

General Info

  • Alternative names

    • Activation inducible TNF related ligand
    • Activation-inducible TNF-related ligand
    • AITR ligand
    • AITRL
    • GITR ligand
    • GITRL
    • Glucocorticoid induced TNF related ligand
    • Glucocorticoid induced TNFR related protein ligand
    • Glucocorticoid-induced TNF-related ligand
    • hGITRL
    • MGC138237
    • TL6
    • TNF18_HUMAN
    • TNFSF18
    • TNLG2A
    • Tumor necrosis factor (ligand) superfamily member 18
    • Tumor necrosis factor ligand 2A
    • Tumor necrosis factor ligand superfamily member 18
    see all
  • Function

    Cytokine that binds to TNFRSF18/AITR/GITR. Important for interactions between activated T-lymphocytes and endothelial cells and may modulate T-lymphocyte survival in peripheral tissues.
  • Tissue specificity

    Expressed at high levels in the small intestine, ovary, testis, kidney and endothelial cells.
  • Sequence similarities

    Belongs to the tumor necrosis factor family.
  • Cellular localization

    Membrane.
  • Information by UniProt

References

ab196127 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab196127.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up