Description

  • Product name

    Recombinant Human TNIP1 protein
  • Purity

    > 75 % SDS-PAGE.
    ab101108 was purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMSNVTASPTAPACPSDKPAPVQKPPSSGTS SEFEVVTPEEQNSPESSSHANAMALGPLPREDGNLMLHLQRLETTLSVCA EEPDHGQLFTHLGRMALEFNRLASKVHKNEQRTSILQTLCEQLRKENEAL KAKLDKGLEQRDQAAERLREENLELKKLLMSNGNKEGASGRPGSPKMEGT GKKAVAGQQQASVTAGKVPEVVALGAAEKKVKMLEQQRSELLEVNKQWDQ HFRSMKQQYEQKITELRQKLADLQKQVTDLEAEREQKQRDFDRKLLLAKS KIEMEETDKEQLTAEAKELRQKVKYLQDQLSPLTRQREYQEKEIQRLNKA LEEALSIQTPPSSPPTAFGSPEGAGALLRKQELVTQNELLKQQVKIFEED FQRERSDRERMNEEKEELKKQVEKLQAQVTLSNAQLKAFKDEEKAREALR QQKRKAKA
    • Predicted molecular weight

      52 kDa including tags
    • Amino acids

      94 to 530
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab101108 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 7.50
    Constituents: 0.077% DTT, 0.316% Tris HCl, 20% Glycerol, 1.16% Sodium chloride

General Info

  • Alternative names

    • ABIN 1
    • HIV-1 Nef-interacting protein
    • hVAN
    • KIAA0113
    • Naf1
    • Nef-associated factor 1
    • Nip40-1
    • TNFAIP3 interacting protein 1
    • TNFAIP3-interacting protein 1
    • TNIP-1
    • Tnip1
    • TNIP1_HUMAN
    • VAN
    • Virion-associated nuclear shuttling protein
    see all
  • Function

    Interacts with zinc finger protein A20/TNFAIP3 and inhibits TNF-induced NF-kappa-B-dependent gene expression by interfering with an RIP- or TRAF2-mediated transactivation signal (By similarity). Increases cell surface CD4(T4) antigen expression. Interacts with HIV-1 matrix protein and is packaged into virions and overexpression can inhibit viral replication. May regulate matrix nuclear localization, both nuclear import of PIC (Preintegration complex) and export of GAG polyprotein and viral genomic RNA during virion production.
  • Tissue specificity

    Ubiquitous. Strongly expressed in peripheral blood lymphocytes, spleen and skeletal muscle, and is weakly expressed in the brain.
  • Cellular localization

    Cytoplasm. Nucleus. Shuttles between the nucleus and cytoplasm in a CRM1-dependent manner.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3µg ab101108.

References

ab101108 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab101108.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up