Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      CDPSRSSGEKDEQTCLMWAYEKGHDAIVTLLKHYKRPQDELPCNEYSQPG GDGSYVSVPSPLGKIKSMTKEKADILLLRAGLPSHFHLQLSEIEFHEIIG
    • Amino acids
      371 to 470
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162410 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Cardiac ankyrin repeat kinase
    • cardiac muscle
    • Cardiac troponin I-interacting kinase
    • CARK
    • CMD1FF
    • CMD2A
    • CMH7
    • cTnl
    • MGC142099
    • MGC33828
    • RCM1
    • Serine/threonine protein kinase TNN13K
    • Serine/threonine-protein kinase TNNI3K
    • TNI3K_HUMAN
    • TNNC1
    • TNNI3 interacting kinase
    • TNNI3-interacting kinase
    • Tnni3k
    • Troponin 1
    see all
  • Function
    May play a role in cardiac physiology.
  • Tissue specificity
    Highly expressed in both adult and fetal heart.
  • Sequence similarities
    Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family. MAP kinase kinase kinase subfamily.
    Contains 10 ANK repeats.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications
    Autophosphorylated.
  • Cellular localization
    Nucleus. Cytoplasm. Expressed at lower levels in the cytoplasm.
  • Information by UniProt

Images

  • ab162410 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162410 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162410.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up