Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MEGAKPTLQLVYQAVQALYHDPDPSGKERASFWLGELQRSVHAWEISDQL LQIRQDVESCYFAAQTMKMKIQTSFYELPTDSHASLRDSLLTHIQNLKDL SPVIVTQLALAIADLALQMPSWKGCVQTLVEKYSNDVTSLPFLLEILTVL PEEVHSRSLRIGANRRTEIIEDLAFYSSTVVSLLMTCVEKAGTDEKMLMK VFRCLGSWFNLGVLDSNFMANNKLLALLFEVLQQDKTSSNLHEAASDCVC SALYA
    • Molecular weight

      93 kDa including tags
    • Amino acids

      1 to 255

Specifications

Our Abpromise guarantee covers the use of ab112402 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

    Other

  • Form

    Liquid
  • Additional notes

    Best to use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione

General Info

  • Alternative names

    • TNPO 3
    • Imp12
    • Importin 12
    • Importin-12
    • IPO12
    • MTR10A
    • TNPO3
    • TNPO3_HUMAN
    • Transportin 3
    • Transportin SR
    • Transportin-3
    • Transportin-SR
    • TRN SR
    • TRN-SR
    • TRN-SR2
    • TRNSR
    see all
  • Function

    Seems to function in nuclear protein import as nuclear transport receptor. In vitro, mediates the nuclear import of splicing factor SR proteins SFRS1 and SFRS2, by recognizing phosphorylated RS domains.
  • Cellular localization

    Cytoplasm. Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab112402. Stained with Coomassie Blue

References

ab112402 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab112402.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up