Description

  • Product name

    Recombinant Human TNRC5 protein
  • Purity

    > 85 % SDS-PAGE.
    ab140562 was purified using conventional chromatography.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSGPSQAGAEENDWVRLPSKCEVCKYVAV ELKSAFEETGKTKEVIGTGYGILDQKASGVKYTKSDLRLIEVTETICKRL LDYSLHKERTGSNRFAKGMSETFETLHNLVHKGVKVVMDIPYELWNETSA EVADLKKQCDVLVEEFEEVIEDWYRNHQEEDLTEFLCANHVLKGKDTSCL AEQWSGKKGDTAALGGKKSKKKSSRAKAAGGRSSSSKQRKELGGLEGDPS PEEDEGIQKASPLTHSPPDEL
    • Predicted molecular weight

      30 kDa including tags
    • Amino acids

      31 to 278
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab140562 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.02% DTT, 0.32% Tris HCl, 10% Glycerol, 0.88% Sodium chloride

General Info

  • Alternative names

    • CAG repeat containing
    • CAG4A
    • Canopy 3 homolog
    • cnpy3
    • CNPY3_HUMAN
    • CTG repeat protein 4a
    • ERDA 5
    • ERDA5
    • Expanded repeat domain CAG/CTG 5
    • Expanded repeat-domain protein CAG/CTG 5
    • OTTHUMP00000016408
    • PRAT4A
    • Protein associated with Tlr4
    • Protein associated with Toll like receptor 4A
    • Protein canopy homolog 3
    • TNRC 5
    • Trinucleotide repeat containing 5
    • Trinucleotide repeat-containing gene 5 protein
    see all
  • Function

    Toll-like receptor (TLR)-specific co-chaperone for HSP90B1. Required for proper TLR folding, except that of TLR3, and hence controls TLR exit from the endoplasmic reticulum. Consequently, required for both innate and adaptive immune responses.
  • Sequence similarities

    Belongs to the canopy family.
    Contains 1 saposin B-type domain.
  • Cellular localization

    Endoplasmic reticulum.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab140562.

References

ab140562 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab140562.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up