Overview

  • Product name
    Recombinant Human TNRC6B protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      DSTLGGAAASNYANSTWGSGASSNNGTSPNPIHIWDKVIVDGSDMEEWPC IASKDTESSSENTTDNNSASNPGSEKSTLPGSTTSNKGKGSQCQSASSGN
    • Amino acids
      153 to 252
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161537 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • KIAA1093
    • TNRC 6B
    • Trinucleotide repeat containing 6B
    • Trinucleotide repeat containing gene 6B protein
  • Relevance
    TNRC6B belongs to the GW182 family. It contains one RRM (RNA recognition motif) domain. TNRC6B plays a role in RNA mediated gene silencing by both micro RNAs (miRNAs) and short interfering RNAs (siRNAs). It is required for miRNA dependent translational repression and siRNA dependent endonucleolytic cleavage of complementary mRNAs by argonaute family proteins. There are three named isoforms.
  • Cellular localization
    Cytoplasm, P-body. Mammalian P-bodies are also known as GW bodies, GWBs.

Images

  • ab161537 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161537 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161537.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up