Overview

  • Product name

    Recombinant Human TOB protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MQLEIQVALNFIISYLYNKLPRRRVNIFGEELERLLKKKYEGHWYPEKPY KGSGFRCIHIGEKVDPVIEQASKESGLDIDDVRGNLPQDLSVWIDPFEVS YQIGEKGPVKVLYVDDNNENGCELDKEIKNSFNPEAQVFMPISDPASSVS SSPSPPFGHSAAVSPTFMPRSTQPLTFTTATFAATKFGSTKMKNSGRSNK VARTSPINLGLNVNDLLKQKAISSSMHSLYGLGLGSQQQPQQQQQPAQPP PPPPPPQQQQQQKTSALSPNAKEFIFPNMQGQGSSTNGMFPGDSPLNLSP LQYSNAFDVFAAYGGLNEKSFVDGLNFSLNNMQYSNQQFQPVMAN
    • Amino acids

      1 to 345
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153052 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • APRO 6
    • APRO6
    • MGC104792
    • MGC34446
    • PIG 49
    • PIG49
    • Proliferation inducing gene 49
    • Protein Tob1
    • RP23 244C22.1
    • TOB
    • TOB 1
    • Tob 1 protein
    • TOB1
    • Tob1 protein
    • Transducer of erbB 2
    • Transducer of ERBB 2 1
    • Transducer of erbB2
    • Transducer of ERBB2 1
    • Trob
    • TROB 1
    • TROB1
    see all
  • Relevance

    The Tob/Btg family of proteins consists of a large number of members. These proteins have a common domain in their amino terminal end and may have anti-proliferative activity in various cell types. The Tob protein was identified in a search for molecules that interact with the receptor tyrosine kinase ErbB2. Active ErbB2 has a negative effect on the anti-proliferative activity of Tob. However, Tob is phosphorylated on serine and threonine residues but not on tyrosine, suggesting that active ErbB2 activates a Ser/Thr kinase that phosphorylates Tob. Unphosphorylated Tob suppresses expression of cyclin D1. It was shown that active p90Rsk1 kinase (known to be activated by protein-tyrosine kinase receptor) phosphorylates Tob on serine and threonine residues in vitro. In addition, Erk1/Erk2 MAP kinases phosphorylate Tob in vivo and in vitro, resulting in suppression of the anti-proliferative activity of Tob. Homozygous Tob knockout mice develop greater bone mass resulting from increased numbers of osteoblasts. Furthermore, it has been shown in osteoblasts, that upon BMP2 (bone morphogenetic protein) activation, Tob associates with receptor regulated Smads (Smad 1, 5, and 8). Thus, osteoblast proliferation and differentiation is negatively regulated by Tob protein through the Smad proteins.

Images

  • ab153052 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153052 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153052.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up