Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MATTVSTQRGPVYIGELPQDFLRITPTQQQRQVQLDAQAAQQLQYGGAVG TVGRLNITVVQAKLAKNYGMTRMDPYCRLRLGYAVYETPTAHNGAKNPRW NKVIHCTVPPGVDSFYLEIFDERAFSMDDRIAWTHITIPESLRQGKVEDK WYSLSGRQGDDKEGMINLVMSYALLPAAMVMPPQPVVLMPTVYQQGVGYV PITGMPAVCSPGMVPVALPPAAVNAQPRCSEEDLKAIQDMFPNMDQEVIR SVLEAQRGNK DAAINSLLQMGEEPVEHHHHHH
    • Molecular weight
      31 kDa including tags
    • Amino acids
      2 to 274
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab172165 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level
    1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle.

    pH: 7.20
    Constituents: 98% PBS, 0.88% Sodium chloride, 0.15% EDTA

General Info

  • Alternative names
    • Adapter protein
    • FLJ33531
    • IL 1RAcPIP
    • IL1RAcPIP
    • TOLIP
    • TOLIP_HUMAN
    • Toll interacting protein
    • Toll-interacting protein
    • tollip
    see all
  • Function
    Component of the signaling pathway of IL-1 and Toll-like receptors. Inhibits cell activation by microbial products. Recruits IRAK1 to the IL-1 receptor complex. Inhibits IRAK1 phosphorylation and kinase activity.
  • Sequence similarities
    Belongs to the tollip family.
    Contains 1 C2 domain.
    Contains 1 CUE domain.
  • Post-translational
    modifications
    Phosphorylated by IRAK1 upon stimulation by IL-1 or microbial products.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • SDS-PAGE gel of ab172165 under reduced (lane 1) and non-reduced (lane 2) conditions.

References

ab172165 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172165.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up