Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MAFGKSHRDPYATSVGHLIEKATFAGVQTEDWGQFMHICDIINTTQDGPK DAVKALKKRISKNYNHKEIQLTLSLIDMCVQNCGPSFQSLIVKKEFVKEN LVKLLNPRYNLPLDIQNRILNFIKTWSQGFPGGVDVSEVKEVYLDLVKKG VQFPPSEAEAETARQETAQISSNPPTSVPTAPALSSVIAPKNSTVTLVPE QIGKLHSELDMVKMNVRVMSAILMENTPGSENHEDIELLQKLYKTGREMQ ERIMDLLVVVENEDVTVELIQVNEDLNNAILGYERFTRNQQRILEQNKNQ KEATNTTSEPSAPSQDLLDLSPSPRMPRATLGELNTMNNQLSGLSK
    • Molecular weight

      65 kDa including tags
    • Amino acids

      1 to 346

Specifications

Our Abpromise guarantee covers the use of ab131851 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 2310045L10Rik
    • C80573
    • OK/KNS CL.3
    • Src activating and signaling molecule
    • Src activating and signaling molecule protein
    • Src-activating and signaling molecule protein
    • SRCASM
    • Target of Myb like protein 1
    • Target of Myb-like protein 1
    • Target of myb1 (chicken) homolog like 1
    • Target of myb1 (chicken) like 1
    • Target of myb1 like 1
    • TM1L1_HUMAN
    • TOM1 L1
    • TOM1 like protein 1
    • TOM1-like protein 1
    • TOM1L1
    • TOM1L1 protein
    see all
  • Function

    Probable adapter protein involved in signaling pathways. Interacts with the SH2 and SH3 domains of various signaling proteins when it is phosphorylated. May promotes FYN activation, possibly by disrupting intramolecular SH3-dependent interactions.
  • Sequence similarities

    Belongs to the TOM1 family.
    Contains 1 GAT domain.
    Contains 1 VHS domain.
  • Post-translational
    modifications

    Phosphorylated on tyrosines by FYN (By similarity). Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization

    Golgi apparatus > Golgi stack. Endosome membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab131851 stained with Coomassie Blue.

References

ab131851 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab131851.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up