Description

  • Product name

    Recombinant Human TOM1L2 protein
  • Purity

    > 80 % SDS-PAGE.
    ab202609 was purified by using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSEFMEFLLGNPFSTPVGQCLEKATDGSL QSEDWTLNMEICDIINETEEGPKDAIRALKKRLNGNRNYREVMLALTVLE TCVKNCGHRFHILVANRDFIDSVLVKIISPKNNPPTIVQDKVLALIQAWA DAFRSSPDLTGVVHIYEELKRKGVEFPMADLDALSPIHTPQRSVPEVDPA ATMPRSQSQQRTSAGSYSSPPPAPYSAPQAPALSVTGPITANSEQIARLR SELDVVRGNTKVMSEMLTEMVPGQEDSSDLELLQELNRTCRAMQQRIVEL ISRVSNEEVTEELLHVNDDLNNVFLRYERFERYRSGRSVQNASNGVLNEV TEDNLIDLGPGSPAVVSPMVGNTAPPSSLSSQLAGLDLGTESVSGTLSSL QQCNPRDGFDMFAQTRGNSLAEQRKTVTYEDPQAVGGLASALDNRKQSSE GIPVAQPSVMDDIEVWLRTDLKGDDLEEGVTSEEFDKFLEERAKAAEMVP DLPSPPMEAPAPASNPSGRKKPERSEDALFAL
    • Predicted molecular weight

      58 kDa including tags
    • Amino acids

      1 to 507
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NCBI Accession No. NP_001076437.

Specifications

Our Abpromise guarantee covers the use of ab202609 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 10% Glycerol, 0.02% DTT, 89% PBS

General Info

  • Alternative names

    • FLJ32746
    • Srebf1
    • Target of Myb-like protein 2
    • Target of myb1 like 2
    • Target of myb1-like 2 (chicken)
    • TM1L2_HUMAN
    • TOM1
    • TOM1-like 2
    • TOM1-like protein 2
    • TOM1L 2
    • Tom1l2
    see all
  • Function

    Probable role in protein transport. May regulate growth factor-induced mitogenic signaling.
  • Tissue specificity

    Ubiquitously expressed with higher expression in heart and skeletal muscle.
  • Sequence similarities

    Belongs to the TOM1 family.
    Contains 1 GAT domain.
    Contains 1 VHS domain.
  • Domain

    The GAT domain mediates interaction with TOLLIP.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab202609 (3μg).

References

ab202609 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab202609.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up