Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MVGRNSAIAAGVCGALFIGYCIYFDRKRRSDPNFKNRLRERRKKQKLAKE RAGLSKLPDLKDAEAVQKFFLEEIQLGEELLAQGEYEKGVDHLTNAIAVC GQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRIVSAQSLAEDDVE
    • Molecular weight

      42 kDa including tags
    • Amino acids

      1 to 145

Specifications

Our Abpromise guarantee covers the use of ab132614 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml. Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • KIAA0016
    • MAS20
    • MGC117367
    • Mitochondrial 20 kDa outer membrane protein
    • Mitochondrial import receptor subunit TOM20 homolog
    • MOM19
    • Outer mitochondrial membrane receptor Tom20
    • TOM20
    • TOM20_HUMAN
    • TOMM20
    • Translocase of outer mitochondrial membrane 20 homolog (yeast)
    • Translocase of outer mitochondrial membrane 20 homolog type II
    see all
  • Function

    Central component of the receptor complex responsible for the recognition and translocation of cytosolically synthesized mitochondrial preproteins. Together with TOM22 functions as the transit peptide receptor at the surface of the mitochondrion outer membrane and facilitates the movement of preproteins into the TOM40 translocation pore.
  • Sequence similarities

    Belongs to the Tom20 family.
  • Cellular localization

    Mitochondrion outer membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132614 stained with Coomassie Blue.

References

ab132614 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132614.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up