Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSDRKRRSDPNFKNRLRERRKKQKLAKER AGLSKLPDLKDAEAVQKFFLEEIQLGEELLAQGEYEKGVDHLTNAIAVCG QPQQLLQVLQQTLPPPVFQMLLTKLPTISQRIVSAQSLAEDDVE
    • Molecular weight
      16 kDa including tags
    • Amino acids
      25 to 145
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab156966 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity
    >90% by SDS-PAGE.
    ab156966 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.04% DTT, 0.32% Tris HCl, 20% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names
    • KIAA0016
    • MAS20
    • MGC117367
    • Mitochondrial 20 kDa outer membrane protein
    • Mitochondrial import receptor subunit TOM20 homolog
    • MOM19
    • Outer mitochondrial membrane receptor Tom20
    • TOM20
    • TOM20_HUMAN
    • TOMM20
    • Translocase of outer mitochondrial membrane 20 homolog (yeast)
    • Translocase of outer mitochondrial membrane 20 homolog type II
    see all
  • Function
    Central component of the receptor complex responsible for the recognition and translocation of cytosolically synthesized mitochondrial preproteins. Together with TOM22 functions as the transit peptide receptor at the surface of the mitochondrion outer membrane and facilitates the movement of preproteins into the TOM40 translocation pore.
  • Sequence similarities
    Belongs to the Tom20 family.
  • Cellular localization
    Mitochondrion outer membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab156966 (3 µg).

References

ab156966 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab156966.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up