Recombinant Human TOMM22 / TOM22 protein (ab163455)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAAAVAAAGAGEPQSPDELLPKGDAEKPEEELEEDDDEELDETLSERLWG LTEMFPERVRSAAGATFDLSLFVAQKMYRFSRAALWIGTTSFMILVLPVV FETEKLQMEQQQQLQQRQILLGPNTGLSGGMPGALPSLPGKI
    • Amino acids
      1 to 142
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163455 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 1C9 2
    • hTom 22
    • hTom22
    • Mitochondrial import receptor subunit TOM 22 homolog
    • Mitochondrial import receptor subunit TOM22 homolog
    • Mitochondrial import receptor Tom 22
    • Mitochondrial import receptor Tom22
    • MST 065
    • MST065
    • MSTP 065
    • MSTP065
    • TOM 22
    • TOM22
    • TOMM 22
    • TOMM22
    • Translocase of outer membrane 22 kDa subunit homolog
    • Translocase of outer mitochondrial membrane 22 homolog
    see all
  • Cellular localization
    Mitochondrion outer membrane; Single-pass membrane protein

Images

  • ab163455 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163455 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163455.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up