Overview

  • Product name
    Recombinant Human Tomosyn protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      GGGAQSLDREELFGESSSGKASRSLAQHIPGPGGIEGVKGAASGVVGELA RARLALDERGQKLGDLEERTAAMLSSAESFSKHAHEIMLKYKDKKWYQF
    • Amino acids
      1017 to 1115
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165387 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FLJ30922
    • Lethal(2) giant larvae protein homolog 3
    • LGL3
    • LLGL3
    • MGC141942
    • MGC141968
    • Nbla04300
    • STXBP5
    • Syntaxin binding protein 5
    • Tomosyn 1
    see all
  • Relevance
    Tomosyn plays a regulatory role in calcium-dependent exocytosis and neurotransmitter release by inhibiting the assembly of trans-SNARE complexes between transport vesicles and the plasma membrane, via the displacement of munc18 from syntaxin-1. There are three splice variants of tomosyn designated m-tomosyn, b-tomosyn and s-tomosyn. Although b-tomosyn is ubiquitously expressed, s-tomosyn and m-tomosyn are expressed primarily in brain.
  • Cellular localization
    Cell Membrane and Cytoplasmic. Note: Cytoplasmic, and associated with vesicular membranes and the plasma membrane. Detected at synapses and on synaptic vesicles

Images

  • ab165387 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165387 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165387.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up