Overview

  • Product name

    Recombinant Human TopBP1 protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      LLQSGGAKVLPGHSVPLFKEATHLFSDLNKLKPDDSGVNIAEAAAQNVYC LRTEYIADYLMQESPPHVENYCLPEAISFIQNNKELGTGLSQKRKAPTEK NKIKRPRVH
    • Amino acids

      1327 to 1435
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161280 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • DNA topoisomerase 2 binding protein 1
    • DNA topoisomerase 2-binding protein 1
    • DNA topoisomerase II binding protein
    • DNA topoisomerase II binding protein 1
    • DNA topoisomerase II-beta-binding protein 1
    • DNA topoisomerase II-binding protein 1
    • DNA topoisomerase IIbeta binding protein 1
    • Hypothetical protein KIAA0259 [Fragment]
    • KIAA0259
    • TOP2BP1
    • TOPB1_HUMAN
    • TOPBP 1
    • TopBP1
    • Topoisomerase (DNA) II binding protein 1
    • Topoisomerase II binding protein 1
    see all
  • Function

    Required for DNA replication. Plays a role in the rescue of stalled replication forks and checkpoint control. Binds double-stranded DNA breaks and nicks as well as single-stranded DNA. Recruits the SWI/SNF chromatin remodeling complex to E2F1-responsive promoters. Down-regulates E2F1 activity and inhibits E2F1-dependent apoptosis during G1/S transition and after DNA damage. Induces a large increase in the kinase activity of ATR.
  • Tissue specificity

    Highly expressed in heart, brain, placenta, lung and kidney.
  • Sequence similarities

    Contains 8 BRCT domains.
  • Post-translational
    modifications

    Phosphorylated on serine and threonine residues in response to X-ray irradiation.
    Ubiquitinated and degraded by the proteasome. X-ray irradiation reduces ubiquitination.
  • Cellular localization

    Nucleus. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Cytoplasm, cytoskeleton, spindle pole. Chromosome. Detected on unpaired autosomes in meiotic prophase cells. Detected on X and Y chromosomes during later stages of prophase. Colocalizes with ATR and H2AFX at unsynapsed chromosome cores during prophase (By similarity). Has a uniform nuclear distribution during G phase. Colocalizes with BRCA1 at stalled replication forks during S phase. In mitotic cells it colocalizes with BRCA1 at spindle poles and centrosomes during metaphase and anaphase. Detected in discrete foci together with PML and numerous DNA repair enzymes after DNA damage by alkylating agents, UV or gamma irradiation. Localizes to sites of DNA damage in a H2AX- independent manner.
  • Information by UniProt

Images

  • ab161280 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161280 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161280.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up