Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      QRLEEQLMKLEVQATDREENKQIALGTSKLNYLDPRITVAWCKKWGVPIE KIYNKTQREKFAWAIDMADEDYEF
    • Amino acids
      692 to 765
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159734 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DNA topoisomerase 1
    • DNA topoisomerase I
    • NUP98 fusion gene
    • TOP 1
    • TOP I
    • TOP1
    • TOP1_HUMAN
    • TOPI
    • Topoisomerase (DNA) I
    • Topoisomerase 1
    • Topoisomerase1
    • TopoisomeraseI
    • Type I DNA topoisomerase
    see all
  • Function
    The reaction catalyzed by topoisomerases leads to the conversion of one topological isomer of DNA to another.
  • Involvement in disease
    Note=A chromosomal aberration involving TOP1 is found in a form of therapy-related myelodysplastic syndrome. Translocation t(11;20)(p15;q11) with NUP98.
  • Sequence similarities
    Belongs to the eukaryotic type I topoisomerase family.
  • Post-translational
    modifications
    Sumoylated. Lys-117 is the main site of sumoylation. Sumoylation plays a role in partitioning TOP1 between nucleoli and nucleoplasm. Levels are dramatically increased on camptothecin (CPT) treatment.
  • Cellular localization
    Nucleus > nucleolus. Nucleus > nucleoplasm. Diffuse nuclear localization with some enrichment in nucleoli. On CPT treatment, cleared from nucleoli into nucleoplasm. Sumolyated forms found in both nucleoplasm and nucleoli.
  • Information by UniProt

Images

  • ab159734 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159734 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159734.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up