Overview

  • Product name
    Recombinant Human Topoisomerase II alpha protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      RAAPKGTKRDPALNSGVSQKPDPAKTKNRRKRKPSTSDDSDSNFEKIVSK AVTSKKSKGESDDFHMDFDSAVAPRAKSVRAKKPIKYLEESDEDDLF
    • Amino acids
      1435 to 1531
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159735 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • alpha isozyme
    • ATP hydrolyzing DNA topoisomerase II alfa
    • DNA gyrase
    • DNA topoisomerase (ATP hydrolyzing)
    • DNA topoisomerase 2 alpha
    • DNA topoisomerase 2-alpha
    • DNA topoisomerase II
    • DNA topoisomerase II 170 kD
    • DNA topoisomerase II alpha isozyme
    • DNA Topoisomerase2
    • TOP 2A
    • TOP2
    • TOP2A
    • TOP2A_HUMAN
    • Topoisomerase DNA II alpha 170kDa
    • TP2A
    see all
  • Function
    Control of topological states of DNA by transient breakage and subsequent rejoining of DNA strands. Topoisomerase II makes double-strand breaks.
  • Sequence similarities
    Belongs to the type II topoisomerase family.
  • Post-translational
    modifications
    Phosphorylation has no effect on catalytic activity.
  • Cellular localization
    Cytoplasm. Nucleus > nucleoplasm. Generally located in the nucleoplasm.
  • Information by UniProt

Images

  • ab159735 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159735 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159735.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up