Overview

  • Product name
    Recombinant Human Torsin B protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      YNDIYCRFAECCREERPLNASALKLDLEEKLFGQHLATEVIFKALTGFRN NKNPKKPLTLSLHGWAGTGKNFVSQIVAENLHPKGLKSNFVHLFV
    • Amino acids
      46 to 140
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162151 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DQ1
    • TOR1B
    • TOR1B_HUMAN
    • Torsin 1B
    • Torsin family 1 member B
    • torsin family 1, member B (torsin B)
    • Torsin-1B
    see all
  • Function
    May serve as a molecular chaperone assisting in the proper folding of secreted and/or membrane proteins.
  • Tissue specificity
    Widely expressed with low levels in brain. Not detected in fetal brain.
  • Sequence similarities
    Belongs to the clpA/clpB family. Torsin subfamily.
  • Cellular localization
    Endoplasmic reticulum lumen.
  • Information by UniProt

Images

  • ab162151 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162151 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162151.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up