Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      SEYEPSWEEQPMPETPKWFHLPYLFQMPAYASSSKFVTRVTTPAQRGKVP PVHHSSPTTQITHRPRVSRASSVAGDKPRTFLPSTTASKISALEGLLKPQ
    • Amino acids

      124 to 223
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160386 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as FAIM3

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Faim3
    • FAIM3_HUMAN
    • Fas apoptotic inhibitory molecule 3
    • Fc fragment of IgM receptor
    • Fc mu receptor
    • FCMR
    • IgM Fc receptor
    • Immunoglobulin mu Fc receptor
    • Regulator of Fas induced apoptosis
    • Regulator of Fas-induced apoptosis Toso
    • TOSO
    see all
  • Function

    May play a role in the immune system processes. Protects cells from FAS-, TNF alpha- and FADD-induced apoptosis without increasing expression of the inhibitors of apoptosis BCL2 and BCLXL. Seems to activate an inhibitory pathway that prevents CASP8 activation following FAS stimulation, rather than blocking apoptotic signals downstream. May inhibit FAS-induced apoptosis by preventing CASP8 processing through CFLAR up-regulation.
  • Tissue specificity

    Expressed in lymph nodes, peripheral blood leukocytes, lung, thymus and kidneys. Very weak expression detected in spleen, liver, heart, and salivary gland. Expressed in lymphoid cell lines such as Jurkat cells, CemT4 cells, MolT-4 cells, HB11.19 cells, and Reh cells. No expression detected in nonhematopoietic cell lines, including HepG2 cells, 293 cells and Hela cells.
  • Sequence similarities

    Contains 1 Ig-like (immunoglobulin-like) domain.
  • Domain

    The Ig-like domain is required for the anti-apoptotic ability.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • ab160386 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160386 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160386.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up