Description

  • Product name

    Recombinant Human TOX4 protein
  • Purity

    > 90 % SDS-PAGE.
    ab211941 was refolded using temperature shift inclusion body refolding technology and chromatographically purified.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MASMTGGQQMGRGHHHHHHENLYFQGGEFEFPGGNDNYLTITGPSHPFLS GAETFHTPSLGDEEFEIPPISLDSDPSLAVSDVVGHFDDLADPSSSQDGS FSAQYGVQTLDMPVGMTHGLMEQGGGLLSGGLTMDLDHSIGTQYSANPPV TIDVPMTDMTSGLMGHSQLTTIDQSELSSQLGLSLGGGTILPPAQSPEDR LSTTPSPTSSLHEDGVEDFRRQLPSQKTVVVEAGKKQKAPKKRKKKDPNE PQKPVSAYALFFRDTQAAIKGQNPNATFGEVSKIVASMWDSLGEEQKQVY KRKTEAAKKEYLKALAAYKDNQECQATVETVELDPAPPSQTPSPPPMATV DPASPAPASIEPPALSPSIVVNSTLSSYVANQASSGAGGQPNITKLIITK QMLPSSITMSQGGMVTVIPATVVTSRGLQLGQTSTATIQPSQQAQIVTRS VLQAAAAAAAAASMQLPPPRLQPPPLQQMPQPPTQQQVTILQQPPPLQAM QQPPPQKVRINLQQQPPPLQIKSVPLPTLKMQTTLVPPTVESSPERPMNN SPEAHTVEAPSPETICEMITDVVPEVESPSQMDVELVSGSPVALSPQPRC VRSGCENPPIVSKDWDNEYCSNECVVKHCRDVFLAWVASRNSNTVVFVK
    • Predicted molecular weight

      69 kDa including tags
    • Amino acids

      2 to 621
    • Tags

      His-T7 tag N-Terminus
    • Additional sequence information

      Constructed with 29 aa N-terminal T7 / His / TEV cleavage site Tag. NP_055643.

Specifications

Our Abpromise guarantee covers the use of ab211941 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C.

General Info

  • Alternative names

    • C14orf92
    • Epidermal Langerhans cell protein LCP1
    • KIAA0737
    • LCP1
    • MIG7
    • Migration inducing protein 7
    • TOX 4
    • TOX high mobility group box family member 4
    • Tox4
    • TOX4_HUMAN
    see all
  • Information by UniProt

References

ab211941 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab211941.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up