Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MEAQAQGLLETEPLQGTDEDAVASADFSSMLSEEEKEELKAELVQLEDEI TTLRQVLSAKERHLVEIKQKLGMNLMNELKQNFSKSWHDMQTTTAYKKTH ETLSHAGQKATAAFSNVGTAISKKFGDMSYSIRHSISMPAMRRK
    • Molecular weight

      41 kDa including tags
    • Amino acids

      1 to 144

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132140 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • D53
    • D54
    • hD53
    • hD54
    • MGC73020
    • MGC8556
    • OTTHUMP00000017133
    • OTTHUMP00000017136
    • Tpd52l1
    • TPD52L2
    • TPD53_HUMAN
    • Tumor protein D52 like 1
    • Tumor protein D52 like 2
    • Tumor protein D52-like 1
    • Tumor protein D53
    • Tumor protein D54
    see all
  • Sequence similarities

    Belongs to the TPD52 family.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132140 stained with Coomassie Blue.

References

ab132140 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132140.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up