Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MPSWALFMVTSCLLLAPQNLAQVSSQDVSLLASDSEPLKCFSRTFEDLTC FWDEEEAAPSGTYQLLYAYPREKPRACPLSSQSMPHFGTRYVCQFPDQEE VRLFFPLHLWVKNVFLNQTRTQRVLFVDSVGLPAPPSIIKAMGGSQPGEL QISWEEPAPEISDFLRYELRYGPRDPKNSTGPTVIQLIATETCCPALQRP HSASALDQSPCAQPTMPWQDGPKQTSPSREASALTAEGGSCLISGLQPGN SYWLQLRSEPDGISLGGSWGSWSLPVTVDLPGDAVALGLQCFTLDLKNVT CQWQQQDHASSQGFFYHSRARCCPRDRYPIWENCEEEEKTNPGLQTPQFS RCHFKSRNDSIIHILVEVTTAPGTVHSYLGSPFWIHQAVRLPTPNLHWRE ISSGHLELEWQHPSSWAAQETCYQLRYTGEGHQDWKVLEPPLGARGGTLE LRPRSRYRLQLRARLNGPTYQGPWSSWSDPTRVETATETAWISLVTALHL VLGLSAVLGLLLLRWQFPAHYRRLRHALWPSLPDLHRVLGQYLRDTAALS PPKATVSDTCEEVEPSLLEILPKSSERTPLPLCSSQAQMDYRRLQPSCLG TMPLSVCPPMAESGSCCTTHIANHSYLPLSYWQQP
    • Molecular weight

      98 kDa including tags
    • Amino acids

      1 to 635

Associated products

Specifications

Our Abpromise guarantee covers the use of ab152537 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.

     This product was previously labelled as TPOR

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • C MPL
    • CD110
    • mpl
    • MPLV
    • Myeloproliferative leukemia protein
    • Myeloproliferative leukemia virus oncogene
    • Proto-oncogene c-Mpl
    • THCYT2
    • Thrombopoietin receptor
    • TPO R
    • TPO-R
    • TPOR
    • TPOR_HUMAN
    see all
  • Function

    Receptor for thrombopoietin. May represent a regulatory molecule specific for TPO-R-dependent immune responses.
  • Tissue specificity

    Expressed at a low level in a large number of cells of hematopoietic origin. Isoform 1 and isoform 2 are always found to be coexpressed.
  • Involvement in disease

    Defects in MPL are a cause of congenital amegakaryocytic thrombocytopenia (CAMT) [MIM:604498]. CAMT is a disease characterized by isolated thrombocytopenia and megakaryocytopenia with no physical anomalies.
  • Sequence similarities

    Belongs to the type I cytokine receptor family. Type 1 subfamily.
    Contains 2 fibronectin type-III domains.
  • Domain

    The WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.
    The box 1 motif is required for JAK interaction and/or activation.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152537 stained with Coomassie Blue.

References

ab152537 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152537.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up