Overview

Description

  • Nature

    Recombinant
  • Source

    Baculovirus infected insect cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      ADPQHAMECHHRIEERSQPVKLESTRTTVRTGLDLKANKTFAYHKDMPLI FIGGVPRSGTTLMRAMLDAHPDIRCGEETRVIPRILALKQMWSRSSKE KI RLDEAGVTDEVLDSAMQAFLLEIIVKHGEPAPYLCNKDPFALKSLT YLSR LFPNAKFLLMVRDGRASVHSMISRKVTIAGFDLNSYRDCLTKWN RAIETM YNQCMEVGYKKCMLVHYEQLVLHPERWMRTLLKFLQIPWNHS VLHHEEMI GKAGGVSLSKVERSTDQVIKPVNVGALSKWVGKIPPDVLQ DMAVIAPMLA KLGYDPYANPPNYGKPDPKIIENTRRVYKGEFQLPDFL KEKPQTEQVEHH HHHH
    • Molecular weight

      41 kDa including tags
    • Amino acids

      26 to 370
    • Tags

      His tag C-Terminus
    • Additional sequence information

      This construct lacks both the cytoplasmic domain and the transmembrane domain. It corresponds to the entire lumenal portion of the protein (residues 26 - 370).

Specifications

Our Abpromise guarantee covers the use of ab222445 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 90 % SDS-PAGE.
    Purified by conventional chromatography techniques.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 10% Glycerol, PBS

General Info

  • Alternative names

    • Protein tyrosine sulfotransferase 1
    • Protein-tyrosine sulfotransferase 1
    • TPST-1
    • TPST1
    • TPST1_HUMAN
    • Tyrosylprotein sulfotransferase 1
    see all
  • Function

    Catalyzes the O-sulfation of tyrosine residues within acidic motifs of polypeptides.
  • Sequence similarities

    Belongs to the protein sulfotransferase family.
  • Cellular localization

    Golgi apparatus membrane.
  • Information by UniProt

Images

  • ab222445 (3μg) was analysed by 15% SDS-PAGE.

    Predicted molecular mass: 40.6 kDa

References

ab222445 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222445.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up