Description

  • Product name

    Recombinant Human TPST2 protein
    See all TPST2 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Baculovirus infected insect cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      ADPQQVLECRAVLAGLRSPRGAMRPEQEELVMVGTNHVEYRYGKAMPLIF VGGVPRSGTTLMRAMLDAHPEVRCGEETRIIPRVLAMRQAWSKSGREKLR LDEAGVTDEVLDAAMQAFILEVIAKHGEPARVLCNKDPFTLKSSVYLSRL FPNSKFLLMVRDGRASVHSMITRKVTIAGFDLSSYRDCLTKWNKAIEVMY AQCMEVGKEKCLPVYYEQLVLHPRRSLKLILDFLGIAWSDAVLHHEDLIG KPGGVSLSKIERSTDQVIKPVNLEALSKWTGHIPGDVVRDMAQIAPMLAQ LGYDPYANPPNYGNPDPFVINNTQRVLKGDYKTPANLKGYFQVNQNSTSS HLGSSHHHHHH
    • Predicted molecular weight

      40 kDa
    • Amino acids

      26 to 377
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab222447 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 10% Glycerol, PBS

General Info

  • Alternative names

    • EC 2.8.2.20
    • Protein tyrosine sulfotransferase 2
    • Protein-tyrosine sulfotransferase 2
    • TANGO13B
    • TPST-2
    • Tpst2
    • TPST2_HUMAN
    • Transport and golgi organization 13 homolog B
    • Tyrosylprotein phosphotransferase 2
    • Tyrosylprotein sulfotransferase 2
    see all
  • Function

    Catalyzes the O-sulfation of tyrosine residues within acidic motifs of polypeptides.
  • Tissue specificity

    Widely expressed.
  • Sequence similarities

    Belongs to the protein sulfotransferase family.
  • Cellular localization

    Golgi apparatus membrane.
  • Information by UniProt

Images

  • 3 μg ab222447 analyzed by 15% SDS-PAGE.

References

ab222447 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222447.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up