Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSSNQPPGGGGGSGGDCPGGKGKSINCSE LNVRESDVRVCDESSCKYGGVCKEDGDGLKCACQFQCHTNYIPVCGSNGD TYQNECFLRRAACKHQKEITVIARGPCYSDNGSGSGEGEEEGSGAEVHRK HSKCGPCKYKAECDEDAENVGCVCNIDCSGYSFNPVCASDGSSYNNPCFV REASCIKQEQIDIRHLGHCTDTDDTSLLGKKDDGLQYRPDVKDASDQRED VYIGNHMPCPENLNGYCIHGKCEFIYSTQKASCRCESGYTGQHCEKTDFS ILYVVPSRQKLTHV
    • Molecular weight
      34 kDa including tags
    • Amino acids
      40 to 330
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab156965 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    >90% by SDS-PAGE.
    ab156965 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 10% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names
    • C9orf2
    • C9orf3 TMEFF1
    • C9orf30 TMEFF1
    • C9orf30 TMEFF1 fusion protein
    • Cancer/testis antigen family 120 member 1
    • CT120.1
    • H 7365
    • H7365
    • MSANTD3-TMEFF1 readthrough
    • TEFF 1
    • TEFF1
    • TEFF1_HUMAN
    • TMEFF 1
    • TMEFF1
    • Tomoregulin-1
    • Tomoregulin-1 precursor
    • TR 1
    • TR-1
    • TR1
    • Transmembrane protein with EGF like and two follistatin like domains 1
    • Transmembrane protein with EGF-like and one follistatin-like domain
    see all
  • Function
    May inhibit NODAL and BMP signaling during neural patterning (By similarity). May be a tumor suppressor in brain cancers.
  • Tissue specificity
    Expressed predominantly in brain, and at lower levels in heart, placenta and skeletal muscle. Down-regulated in brain tumors as compared to control brain tissues.
  • Sequence similarities
    Belongs to the tomoregulin family.
    Contains 1 EGF-like domain.
    Contains 2 Kazal-like domains.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab156965 (3 µg).

References

ab156965 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab156965.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up