Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      SELNVRESDVRVCDESSCKYGGVCKEDGDGLKCACQFQCHTNYIPVCGSN GDTYQNECFLRRAACKHQKEITVIARGPCYSDNGSGSGEGEEEGSGAEVH RKHSKCGP
    • Amino acids
      65 to 172
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160103 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C9orf2
    • C9orf3 TMEFF1
    • C9orf30 TMEFF1
    • C9orf30 TMEFF1 fusion protein
    • Cancer/testis antigen family 120 member 1
    • CT120.1
    • H 7365
    • H7365
    • MSANTD3-TMEFF1 readthrough
    • TEFF 1
    • TEFF1
    • TEFF1_HUMAN
    • TMEFF 1
    • TMEFF1
    • Tomoregulin-1
    • Tomoregulin-1 precursor
    • TR 1
    • TR-1
    • TR1
    • Transmembrane protein with EGF like and two follistatin like domains 1
    • Transmembrane protein with EGF-like and one follistatin-like domain
    see all
  • Function
    May inhibit NODAL and BMP signaling during neural patterning (By similarity). May be a tumor suppressor in brain cancers.
  • Tissue specificity
    Expressed predominantly in brain, and at lower levels in heart, placenta and skeletal muscle. Down-regulated in brain tumors as compared to control brain tissues.
  • Sequence similarities
    Belongs to the tomoregulin family.
    Contains 1 EGF-like domain.
    Contains 2 Kazal-like domains.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • ab160103 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160103 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160103.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up