Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MTHSLVCPETVSRVSSVLNRNTRQFGKKHLFDQDEETCWNSDQGPSQWVT LEFPQLIRVSQLQIQFQGGFSSRRGCLEGSQGTQALHKIVDFYPEDNNSL QTFPIPAAEVDRLKVTFEDATDFFGRVVIYHLRVLGEKV
    • Amino acids
      1 to 139
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165254 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • nr2c2ap
    • NR2CA_HUMAN
    • Nuclear receptor 2C2 associated protein
    • Nuclear receptor 2C2-associated protein
    • Repressor for TR4 transactivation
    • TR4 orphan receptor associated 16 kDa protein
    • TR4 orphan receptor associated protein TRA16
    • TR4 orphan receptor-associated 16 kDa protein
    see all
  • Function
    May act as a repressor of NR2C2-mediated transactivation by suppressing the binding between NR2C2/TR4 and the TR4-response element in target genes.
  • Tissue specificity
    Expressed in all tissue examined, with highest expression in heart, skeletal muscle and pancreas.
  • Sequence similarities
    Belongs to the NR2C2AP family.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab165254 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165254 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165254.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up