Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MSDVEENNFEGRESRSQSKSPTGTPARVKSESRSGSRSPSRVSKHSESHS RSRSKSRSRSRRHSHRRYTRSRSHSHSHRRRSRSRSYTPEYRRRRSRSHS PMSNRRRHTGSRANPDPNTCLGVFGLSLYTTERDLREVFSRYGPLSGVNV VYDQRTGRSRGFAFVYFERIDDSKEAMERANGMELDGRRIRVDYSITKRA HTPTPGIYMGRPTHSGGGGGGGGGGGGGGGGRRRDSYYDRGYDRGYDRYE DYDYRYRRRSPSPYYSRYRSRSRSRSYSPRRY
    • Amino acids

      1 to 282
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162250 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • AWMS1
    • HSU53209
    • htra-2 alpha
    • Putative MAPK activating protein PM24
    • TRA 2 alpha
    • TRA 2A
    • TRA-2 alpha
    • TRA2 alpha
    • TRA2-alpha
    • TRA2A
    • TRA2A_HUMAN
    • Tra2alpha
    • Transformer 2 alpha
    • Transformer 2 protein homolog
    • Transformer-2 protein homolog A
    • Transformer-2 protein homolog alpha
    see all
  • Function

    Sequence-specific RNA-binding protein which participates in the control of pre-mRNA splicing.
  • Sequence similarities

    Belongs to the splicing factor SR family.
    Contains 1 RRM (RNA recognition motif) domain.
  • Post-translational
    modifications

    Phosphorylated in the RS domains.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • ab162250 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162250 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162250.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up