Description

  • Product name

    Recombinant Human TRAF1 protein
    See all TRAF1 proteins and peptides
  • Purity

    > 85 % Densitometry.

  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MASSSGSSPRPAPDENEFPFGCPPTVCQDPKEPRALCCAGCLSENPRNGE DQICPKCRGEDLQSISPGSRLRTQEKAHPEVAEAGIGCPFAGVGCSFKGS PQSVQEHEVTSQTSHLNLLLGFMKQWKARLGCGLESGPMALEQNLSDLQL QAAVEVAGDLEVDCYRAPCSESQEELALQHFMKEKLLAELEGKLRVFENI VAVLNKEVEASHLALATSIHQSQLDRERILSLEQRVVELQQTLAQKDQAL GKLEQSLRLMEEASFDGTFLWKITNVTRRCHESACGRTVSLFSPAFYTAK YGYKLCLRLYLNGDGTGKRTHLSLFIVIMRGEYDALLPWPFRNKVTFMLL DQNNREHAIDAFRPDLSSASFQRPQSETNVASGCPLFFPLSKLQSPKHAY VKDDTMFLKCIVETST
    • Predicted molecular weight

      74 kDa including tags
    • Amino acids

      1 to 416
    • Tags

      GST tag N-Terminus
    • Additional sequence information

      NM_005658.

Specifications

Our Abpromise guarantee covers the use of ab204101 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.5
    Constituents: 0.79% Tris HCl, 0.87% Sodium chloride, 0.31% Glutathione, 0.003% EDTA, 0.004% DTT, 0.002% PMSF, 25% Glycerol

General Info

  • Alternative names

    • 4732496E14Rik
    • EBI6
    • EBV induced protein 6
    • Epstein-Barr virus-induced protein 6
    • MGC:10353
    • Tnf receptor associated factor 1
    • TNF receptor-associated factor 1
    • TRAF 1
    • TRAF1
    • TRAF1_HUMAN
    see all
  • Function

    Adapter molecule that regulates the activation of NF-kappa-B and JNK. Plays a role in the regulation of cell survival and apoptosis. The heterotrimer formed by TRAF1 and TRAF2 is part of a E3 ubiquitin-protein ligase complex that promotes ubiquitination of target proteins, such as MAP3K14. The TRAF1/TRAF2 complex recruits the antiapoptotic E3 protein-ubiquitin ligases BIRC2 and BIRC3 to TNFRSF1B/TNFR2.
  • Sequence similarities

    Contains 1 MATH domain.
  • Domain

    The coiled coil domain mediates homo- and hetero-oligomerization.
    The MATH/TRAF domain binds to receptor cytoplasmic domains.
    Cleavage by CASP8 liberates a C-terminal fragment that promotes apoptosis and inhibits the activation of NF-kappa-B in response to TNF signaling.
  • Post-translational
    modifications

    Polyubiquitinated by BIRC2 and/or BIRC3, leading to its subsequent proteasomal degradation.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab204101.

References

ab204101 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204101.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up