Description

  • Product name

    Recombinant human TRAIL protein
    See all TRAIL proteins and peptides
  • Biological activity

    Induces apoptosis of Human Jurkat T cells in a concentration range of 5-50ng/ml in the presence of 1µg/ml TNF Ligands Enhancer. In the absence of TNF Ligands Enhancer, ab109360 is poorly active.
  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 0.100 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      TSEETISTVQEKQQNISPLVRERGPQRVAAHITGTRGRSNTLSSPN SKNEKALGRKINSWESSRSGHSFLSNLHLRNGELVIHEKGFYYIYSQTYF RFQEEIKENTKNDKQMVQYIYKYTSYPDPILLMKSARNSCWSKDAEYGLY SIYQGGIFELKENDRIFVSVTNEHLIDMDHEASFFGAFLVG
    • Predicted molecular weight

      23 kDa including tags
    • Amino acids

      95 to 281
    • Tags

      DDDDK tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab109360 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.

    Constituent: PBS

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstitute with 100µl sterile water. PBS containing at least 0.1% BSA should be used for further dilutions.

General Info

  • Alternative names

    • Apo 2 ligand
    • APO 2L
    • Apo-2 ligand
    • Apo-2L
    • APO2L
    • CD253
    • CD253 antigen
    • Chemokine tumor necrosis factor ligand superfamily member 10
    • Protein TRAIL
    • TL2
    • TNF Related Apoptosis Inducing Ligand
    • TNF related apoptosis inducing ligand TRAIL
    • TNF-related apoptosis-inducing ligand
    • TNF10_HUMAN
    • TNFSF10
    • TRAIL
    • Tumor necrosis factor (ligand) family member 10
    • Tumor Necrosis Factor (ligand) Superfamily Member 10
    • Tumor necrosis factor apoptosis inducing ligand splice variant delta
    • Tumor necrosis factor ligand superfamily member 10
    see all
  • Function

    Cytokine that binds to TNFRSF10A/TRAILR1, TNFRSF10B/TRAILR2, TNFRSF10C/TRAILR3, TNFRSF10D/TRAILR4 and possibly also to TNFRSF11B/OPG. Induces apoptosis. Its activity may be modulated by binding to the decoy receptors TNFRSF10C/TRAILR3, TNFRSF10D/TRAILR4 and TNFRSF11B/OPG that cannot induce apoptosis.
  • Tissue specificity

    Widespread; most predominant in spleen, lung and prostate.
  • Sequence similarities

    Belongs to the tumor necrosis factor family.
  • Cellular localization

    Membrane.
  • Information by UniProt

References

ab109360 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Question
Answer

Thank you for contacting us.
I have attached the data for the Functional Studies done with ab2219. We will add these to the datasheet as well very soon.
Also, I wanted to send you the information about our 3 for 2 promotion for all proteins that is going on until the end of the month.
https://www.abcam.com/index.html?pageconfig=resource&rid=15079
I hope this information is helpful to you. Please do not hesitate to contact us if you need any more advice or information.
Use our products? Submit an Abreview. Earn rewards!
https://www.abcam.com/abreviews

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up