For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    recombinant-human-trail-protein-ab109360.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Cell Biology Apoptosis Extracellular Signals Death Ligands
Share by email
Bioactive grade

Recombinant human TRAIL protein (ab109360)

  • Datasheet
Submit a review Q&A (1)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Key features and details

  • Expression system: Escherichia coli
  • Purity: > 95% SDS-PAGE
  • Endotoxin level: < 0.100 Eu/µg
  • Active: Yes
  • Tags: DDDDK tag N-Terminus
  • Suitable for: SDS-PAGE, Functional Studies

You may also be interested in

ELISA
Product image
Human TRAIL ELISA Kit (CD253) (ab46074)

View more associated products

Description

  • Product name

    Recombinant human TRAIL protein
    See all TRAIL proteins and peptides
  • Biological activity

    Induces apoptosis of Human Jurkat T cells in a concentration range of 5-50ng/ml in the presence of 1µg/ml TNF Ligands Enhancer. In the absence of TNF Ligands Enhancer, ab109360 is poorly active.
  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 0.100 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

    P50591
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      TSEETISTVQEKQQNISPLVRERGPQRVAAHITGTRGRSNTLSSPN SKNEKALGRKINSWESSRSGHSFLSNLHLRNGELVIHEKGFYYIYSQTYF RFQEEIKENTKNDKQMVQYIYKYTSYPDPILLMKSARNSCWSKDAEYGLY SIYQGGIFELKENDRIFVSVTNEHLIDMDHEASFFGAFLVG
    • Predicted molecular weight

      23 kDa including tags
    • Amino acids

      95 to 281
    • Tags

      DDDDK tag N-Terminus

Associated products

  • Related Products

    • Anti-DDDDK tag (Binds to FLAG® tag sequence) antibody (ab1162)
    • Anti-DDDDK tag (Binds to FLAG® tag sequence) antibody (ab1257)
    • Anti-DDDDK tag (Binds to FLAG® tag sequence) antibody [F-tag-01] (ab18230)
    • Anti-DDDDK tag (Binds to FLAG® tag sequence) antibody (ab21536)
    • Anti-TRAIL antibody [2E5] (ab2219)
    • HRP Anti-DDDDK tag (Binds to FLAG® tag sequence) antibody [M2] (ab49763)

Specifications

Our Abpromise guarantee covers the use of ab109360 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Lyophilized
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.

    Constituent: PBS

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstitute with 100µl sterile water. PBS containing at least 0.1% BSA should be used for further dilutions.

General Info

  • Alternative names

    • Apo 2 ligand
    • APO 2L
    • Apo-2 ligand
    • Apo-2L
    • APO2L
    • CD253
    • CD253 antigen
    • Chemokine tumor necrosis factor ligand superfamily member 10
    • Protein TRAIL
    • TL2
    • TNF Related Apoptosis Inducing Ligand
    • TNF related apoptosis inducing ligand TRAIL
    • TNF-related apoptosis-inducing ligand
    • TNF10_HUMAN
    • TNFSF10
    • TRAIL
    • Tumor necrosis factor (ligand) family member 10
    • Tumor Necrosis Factor (ligand) Superfamily Member 10
    • Tumor necrosis factor apoptosis inducing ligand splice variant delta
    • Tumor necrosis factor ligand superfamily member 10
    see all
  • Function

    Cytokine that binds to TNFRSF10A/TRAILR1, TNFRSF10B/TRAILR2, TNFRSF10C/TRAILR3, TNFRSF10D/TRAILR4 and possibly also to TNFRSF11B/OPG. Induces apoptosis. Its activity may be modulated by binding to the decoy receptors TNFRSF10C/TRAILR3, TNFRSF10D/TRAILR4 and TNFRSF11B/OPG that cannot induce apoptosis.
  • Tissue specificity

    Widespread; most predominant in spleen, lung and prostate.
  • Sequence similarities

    Belongs to the tumor necrosis factor family.
  • Cellular localization

    Membrane.
  • Target information above from: UniProt accession P50591 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

Protocols

To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

Click here to view the general protocols

Datasheets and documents

    • Datasheet
  • References (0)

    Publishing research using ab109360? Please let us know so that we can cite the reference in this datasheet.

    ab109360 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a question

    Question

    send functional study data for ab2219

    Read More

    Abcam community

    Verified customer

    Asked on Jun 08 2012

    Answer

    Thank you for contacting us.
    I have attached the data for the Functional Studies done with ab2219. We will add these to the datasheet as well very soon.
    Also, I wanted to send you the information about our 3 for 2 promotion for all proteins that is going on until the end of the month.
    https://www.abcam.com/index.html?pageconfig=resource&rid=15079
    I hope this information is helpful to you. Please do not hesitate to contact us if you need any more advice or information.
    Use our products? Submit an Abreview. Earn rewards!
    https://www.abcam.com/abreviews

    Read More

    Abcam Scientific Support

    Answered on Jun 08 2012

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.