Recombinant human TRAIL protein (ab109360)
Key features and details
- Expression system: Escherichia coli
- Purity: > 95% SDS-PAGE
- Endotoxin level: < 0.100 Eu/µg
- Active: Yes
- Tags: DDDDK tag N-Terminus
- Suitable for: SDS-PAGE, Functional Studies
Description
-
Product name
Recombinant human TRAIL protein
See all TRAIL proteins and peptides -
Biological activity
Induces apoptosis of Human Jurkat T cells in a concentration range of 5-50ng/ml in the presence of 1µg/ml TNF Ligands Enhancer. In the absence of TNF Ligands Enhancer, ab109360 is poorly active. -
Purity
> 95 % SDS-PAGE. -
Endotoxin level
< 0.100 Eu/µg -
Expression system
Escherichia coli -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
TSEETISTVQEKQQNISPLVRERGPQRVAAHITGTRGRSNTLSSPN SKNEKALGRKINSWESSRSGHSFLSNLHLRNGELVIHEKGFYYIYSQTYF RFQEEIKENTKNDKQMVQYIYKYTSYPDPILLMKSARNSCWSKDAEYGLY SIYQGGIFELKENDRIFVSVTNEHLIDMDHEASFFGAFLVG -
Predicted molecular weight
23 kDa including tags -
Amino acids
95 to 281 -
Tags
DDDDK tag N-Terminus
-
Associated products
-
Related Products
- Anti-DDDDK tag (Binds to FLAG® tag sequence) antibody (ab1162)
- Anti-DDDDK tag (Binds to FLAG® tag sequence) antibody (ab1257)
- Anti-DDDDK tag (Binds to FLAG® tag sequence) antibody [F-tag-01] (ab18230)
- Anti-DDDDK tag (Binds to FLAG® tag sequence) antibody (ab21536)
- Anti-TRAIL antibody [2E5] (ab2219)
- HRP Anti-DDDDK tag (Binds to FLAG® tag sequence) antibody [M2] (ab49763)
Specifications
Our Abpromise guarantee covers the use of ab109360 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
Functional Studies
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
Constituent: PBS
This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconstitute with 100µl sterile water. PBS containing at least 0.1% BSA should be used for further dilutions.
General Info
-
Alternative names
- Apo 2 ligand
- APO 2L
- Apo-2 ligand
see all -
Function
Cytokine that binds to TNFRSF10A/TRAILR1, TNFRSF10B/TRAILR2, TNFRSF10C/TRAILR3, TNFRSF10D/TRAILR4 and possibly also to TNFRSF11B/OPG. Induces apoptosis. Its activity may be modulated by binding to the decoy receptors TNFRSF10C/TRAILR3, TNFRSF10D/TRAILR4 and TNFRSF11B/OPG that cannot induce apoptosis. -
Tissue specificity
Widespread; most predominant in spleen, lung and prostate. -
Sequence similarities
Belongs to the tumor necrosis factor family. -
Cellular localization
Membrane. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab109360 has not yet been referenced specifically in any publications.