Description

  • Product name

    Recombinant human TRAIL protein
    See all TRAIL proteins and peptides
  • Biological activity

    Induces apoptosis in U937 cells at 1µg/ml, within 5 hours. At 0.5-2.0µg/ml, induces apoptosis in various thyroid carcinoma lines within 18 hours. User must determine optimal concentrations and time course for induction. Please note that this protein does not require a cross-linking enhancer to exhibit this potent activity.
  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 0.100 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      VRERGPQRVAAHITGTRGRSNTLSSPNSKNEKALGRKINSWESSRSGHSF LSNLHLRNGELVIHEKGFYYIYSQTYFRFQEEIKENTKNDKQMVQYIYKY TSYPDPILLMKSARNSCWSKDAEYGLYSIYQGGIFELKENDRIFVSVTNE HLIDMDHEASFFGAFLVG
    • Predicted molecular weight

      20 kDa
    • Amino acids

      114 to 281

Specifications

Our Abpromise guarantee covers the use of ab157018 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Induces apoptosis in responsive cells, especially transformed cells and tumors.
    Prolonged storage of TRAIL dilutions at a lower ionic strength than that of the product storage buffer may cause the TRAIL to precipitate. It is therefore recommended that dilution to working concentrations be done shortly before application to cells.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    Constituents: 0.021% Potassium chloride, 0.027% Potassium phosphate, 0.002% DTT, 10% Glycerol, 2.92% Sodium chloride

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • Apo 2 ligand
    • APO 2L
    • Apo-2 ligand
    • Apo-2L
    • APO2L
    • CD253
    • CD253 antigen
    • Chemokine tumor necrosis factor ligand superfamily member 10
    • Protein TRAIL
    • TL2
    • TNF Related Apoptosis Inducing Ligand
    • TNF related apoptosis inducing ligand TRAIL
    • TNF-related apoptosis-inducing ligand
    • TNF10_HUMAN
    • TNFSF10
    • TRAIL
    • Tumor necrosis factor (ligand) family member 10
    • Tumor Necrosis Factor (ligand) Superfamily Member 10
    • Tumor necrosis factor apoptosis inducing ligand splice variant delta
    • Tumor necrosis factor ligand superfamily member 10
    see all
  • Function

    Cytokine that binds to TNFRSF10A/TRAILR1, TNFRSF10B/TRAILR2, TNFRSF10C/TRAILR3, TNFRSF10D/TRAILR4 and possibly also to TNFRSF11B/OPG. Induces apoptosis. Its activity may be modulated by binding to the decoy receptors TNFRSF10C/TRAILR3, TNFRSF10D/TRAILR4 and TNFRSF11B/OPG that cannot induce apoptosis.
  • Tissue specificity

    Widespread; most predominant in spleen, lung and prostate.
  • Sequence similarities

    Belongs to the tumor necrosis factor family.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab157018 (4-20% acrylamide) stained with Coomassie Blue. MWs (kDa) of marker proteins are indicated by numbers to the left. NOTE: TRAIL migrates anomalously in this gel system, with an apparent MW of ~18 kDa.

References

ab157018 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab157018.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up