Description

  • Product name

    Recombinant Human Transaldolase 1 protein
  • Purity

    > 90 % SDS-PAGE.
    ab99243 is purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMSSSPVKRQRMESALDQLKQFTTVVADTGD FHAIDEYKPQDATTNPSLILAAAQMPAYQELVEEAIAYGRKLGGSQEDQI KNAIDKLFVLFGAEILKKIPGRVSTEVDARLSFDKDAMVARARRLIELYK EAGISKDRILIKLSSTWEGIQAGKELEEQHGIHCNMTLLFSFAQAVACAE AGVTLISPFVGRILDWHVANTDKKSYEPLEDPGVKSVTKIYNYYKKFSYK TIVMGASFRNTGEIKALAGCDFLTISPKLLGELLQDNAKLVPVLSAKAAQ ASDLEKIHLDEKSFRWLHNEDQMAVEKLSDGIRKFAADAVKLERMLTERM FNAENGK
    • Predicted molecular weight

      40 kDa including tags
    • Amino acids

      1 to 337
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab99243 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.316% Tris HCl, 10% Glycerol

General Info

  • Alternative names

    • Dihydroxyacetone transferase
    • EC 2.2.1.2
    • EPS8L2
    • Glycerone transferase
    • TAL
    • TAL H
    • TALDO
    • TALDO_HUMAN
    • TALDO1
    • TALDOR
    • TALH
    • Transaldolase
    • Transaldolase 1
    see all
  • Function

    Transaldolase is important for the balance of metabolites in the pentose-phosphate pathway.
  • Pathway

    Carbohydrate degradation; pentose phosphate pathway; D-glyceraldehyde 3-phosphate and beta-D-fructose 6-phosphate from D-ribose 5-phosphate and D-xylulose 5-phosphate (non-oxidative stage): step 2/3.
  • Involvement in disease

    Defects in TALDO1 are the cause of transaldolase 1 deficiency (TALDO1 deficiency) [MIM:606003]. It results in telangiectases of the skin, hepatosplenomegaly, and enlarged clitoris.
  • Sequence similarities

    Belongs to the transaldolase family. Type 1 subfamily.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab99243 at approximately 39.7kDa (3µg).

References

ab99243 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab99243.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up