Recombinant Human Transferrin Receptor (biotinylated ) protein (Biotin) (ab204215)

Description

  • Product name

    Recombinant Human Transferrin Receptor (biotinylated ) protein (Biotin)
    See all Transferrin Receptor proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      CKGVEPKTECERLAGTESPVREEPGEDFPAARRLYWDDLKRKLSEKLDST DFTGTIKLLNENSYVPREAGSQKDENLALYVENQFREFKLSKVWRDQHFV KIQVKDSAQNSVIIVDKNGRLVYLVENPGGYVAYSKAATVTGKLVHANFG TKKDFEDLYTPVNGSIVIVRAGKITFAEKVANAESLNAIGVLIYMDQTKF PIVNAELSFFGHAHLGTGDPYTPGFPSFNHTQFPPSRSSGLPNIPVQTIS RAAAEKLFGNMEGDCPSDWKTDSTCRMVTSESKNVKLTVSNVLKEIKILN IFGVIKGFVEPDHYVVVGAQRDAWGPGAAKSGVGTALLLKLAQMFSDMVL KDGFQPSRSIIFASWSAGDFGSVGATEWLEGYLSSLHLKAFTYINLDKAV LGTSNFKVSASPLLYTLIEKTMQNVKHPVTGQFLYQDSNWASKVEKLTLD NAAFPFLAYSGIPAVSFCFCEDTDYPYLGTTMDTYKELIERIPELNKVAR AAAEVAGQFVIKLTHDVELNLDYERYNSQLLSFVRDLNQYRADIKEMGLS LQWLYSARGDFFRATSRLTTDFGNAEKTDRFVMKKLNDRVMRVEYHFLSP YVSPKESPFRHVFWGSGSHTLPALLENLKLRKQNNGAFNETLFRNQLALA TWTIQGAANALSGDVWDIDNEF
    • Predicted molecular weight

      76 kDa
    • Amino acids

      89 to 760
    • Modifications

      biotinylated
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Extracellular domain of CD71.
  • Conjugation

    Biotin

Specifications

Our Abpromise guarantee covers the use of ab204215 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Additional notes

    Biological activity: Measured by its binding ability in a functional ELISA. Immoblized Human Transferrin, His Tag (ab155698) at 2μg/mL (100μL/well) can bind Biotinylated Human Transferrin R, His Tag (ab204215) with a linear range of 5-156 ng/mL.  

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at 4°C prior to reconstitution. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 5% Trehalose, PBS

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in 1000 µl sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • CD 71
    • CD71
    • CD71 antigen
    • IMD46
    • OTTHUMP00000208523
    • OTTHUMP00000208524
    • OTTHUMP00000208525
    • p90
    • sTfR
    • T9
    • TfR
    • TFR 1
    • TfR1
    • TFR1_HUMAN
    • TFRC
    • TR
    • Transferrin receptor (p90 CD71)
    • Transferrin receptor protein 1, serum form
    • Trfr
    see all
  • Function

    Cellular uptake of iron occurs via receptor-mediated endocytosis of ligand-occupied transferrin receptor into specialized endosomes. Endosomal acidification leads to iron release. The apotransferrin-receptor complex is then recycled to the cell surface with a return to neutral pH and the concomitant loss of affinity of apotransferrin for its receptor. Transferrin receptor is necessary for development of erythrocytes and the nervous system (By similarity). A second ligand, the heditary hemochromatosis protein HFE, competes for binding with transferrin for an overlapping C-terminal binding site. Positively regulates T and B cell proliferation through iron uptake (PubMed:26642240).
    (Microbial infection) Acts as a receptor for new-world arenaviruses: Guanarito, Junin and Machupo virus.
  • Involvement in disease

    Immunodeficiency 46
  • Sequence similarities

    Belongs to the peptidase M28 family. M28B subfamily.
    Contains 1 PA (protease associated) domain.
  • Post-translational
    modifications

    N- and O-glycosylated, phosphorylated and palmitoylated. The serum form is only glycosylated.
    Proteolytically cleaved on Arg-100 to produce the soluble serum form (sTfR).
    Palmitoylated on both Cys-62 and Cys-67. Cys-62 seems to be the major site of palmitoylation.
  • Cellular localization

    Secreted and Cell membrane. Melanosome. Identified by mass spectrometry in melanosome fractions from stage I to stage IV.
  • Information by UniProt

Images

  • SDS-PAGE showing ab204215. Protein migrates as 80-85 kDa in SDS-PAGE due to glycosylation.

References

ab204215 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204215.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up