Recombinant Human Transferrin Receptor protein (ab159687)
Key features and details
- Expression system: Wheat germ
- Tags: GST tag N-Terminus
- Suitable for: ELISA, WB
Description
-
Product name
Recombinant Human Transferrin Receptor protein
See all Transferrin Receptor proteins and peptides -
Expression system
Wheat germ -
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
YGTIAVIVFFLIGFMIGYLGYCKGVEPKTECERLAGTESPVREEPGEDFP AARRLYWDDLKRKLSEKLDSTDFTGTIKLLNENSYVPREAGSQKDENLAL Y -
Amino acids
68 to 168 -
Tags
GST tag N-Terminus
-
Associated products
Specifications
Our Abpromise guarantee covers the use of ab159687 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
ELISA
Western blot
-
Form
Liquid -
Additional notes
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
pH: 8.00
Constituents: 0.31% Glutathione, 0.79% Tris HCl
General Info
-
Alternative names
- CD 71
- CD71
- CD71 antigen
see all -
Function
Cellular uptake of iron occurs via receptor-mediated endocytosis of ligand-occupied transferrin receptor into specialized endosomes. Endosomal acidification leads to iron release. The apotransferrin-receptor complex is then recycled to the cell surface with a return to neutral pH and the concomitant loss of affinity of apotransferrin for its receptor. Transferrin receptor is necessary for development of erythrocytes and the nervous system (By similarity). A second ligand, the heditary hemochromatosis protein HFE, competes for binding with transferrin for an overlapping C-terminal binding site. Positively regulates T and B cell proliferation through iron uptake (PubMed:26642240).
(Microbial infection) Acts as a receptor for new-world arenaviruses: Guanarito, Junin and Machupo virus. -
Involvement in disease
Immunodeficiency 46 -
Sequence similarities
Belongs to the peptidase M28 family. M28B subfamily.
Contains 1 PA (protease associated) domain. -
Post-translational
modificationsN- and O-glycosylated, phosphorylated and palmitoylated. The serum form is only glycosylated.
Proteolytically cleaved on Arg-100 to produce the soluble serum form (sTfR).
Palmitoylated on both Cys-62 and Cys-67. Cys-62 seems to be the major site of palmitoylation. -
Cellular localization
Secreted and Cell membrane. Melanosome. Identified by mass spectrometry in melanosome fractions from stage I to stage IV. - Information by UniProt
Images
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab159687 has not yet been referenced specifically in any publications.