Recombinant Human Transferrin Receptor protein (ab159687)
- Datasheet
- References
- Protocols
Overview
-
Product nameRecombinant Human Transferrin Receptor protein
See all Transferrin Receptor proteins and peptides -
Protein lengthProtein fragment
Description
-
NatureRecombinant
-
SourceWheat germ
-
Amino Acid Sequence
-
SpeciesHuman
-
SequenceYGTIAVIVFFLIGFMIGYLGYCKGVEPKTECERLAGTESPVREEPGEDFP AARRLYWDDLKRKLSEKLDSTDFTGTIKLLNENSYVPREAGSQKDENLAL Y
-
Amino acids68 to 168
-
TagsGST tag N-Terminus
-
Specifications
Our Abpromise guarantee covers the use of ab159687 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
ELISA
Western blot
-
FormLiquid
-
Additional notesProtein concentration is above or equal to 0.05 mg/ml.
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
pH: 8.00
Constituents: 0.31% Glutathione, 0.79% Tris HCl
General Info
-
Alternative names
- CD 71
- CD71
- CD71 antigen
see all -
FunctionCellular uptake of iron occurs via receptor-mediated endocytosis of ligand-occupied transferrin receptor into specialized endosomes. Endosomal acidification leads to iron release. The apotransferrin-receptor complex is then recycled to the cell surface with a return to neutral pH and the concomitant loss of affinity of apotransferrin for its receptor. Transferrin receptor is necessary for development of erythrocytes and the nervous system (By similarity). A second ligand, the heditary hemochromatosis protein HFE, competes for binding with transferrin for an overlapping C-terminal binding site. Positively regulates T and B cell proliferation through iron uptake (PubMed:26642240).
(Microbial infection) Acts as a receptor for new-world arenaviruses: Guanarito, Junin and Machupo virus. -
Involvement in diseaseImmunodeficiency 46
-
Sequence similaritiesBelongs to the peptidase M28 family. M28B subfamily.
Contains 1 PA (protease associated) domain. -
Post-translational
modificationsN- and O-glycosylated, phosphorylated and palmitoylated. The serum form is only glycosylated.
Proteolytically cleaved on Arg-100 to produce the soluble serum form (sTfR).
Palmitoylated on both Cys-62 and Cys-67. Cys-62 seems to be the major site of palmitoylation. -
Cellular localizationSecreted and Cell membrane. Melanosome. Identified by mass spectrometry in melanosome fractions from stage I to stage IV.
- Information by UniProt
Images
-
SDS-PAGE - Recombinant Human Transferrin Receptor protein (ab159687)ab159687 on a 12.5% SDS-PAGE stained with Coomassie Blue.
Datasheets and documents
References
ab159687 has not yet been referenced specifically in any publications.
