Recombinant Human Transglutaminase 5/TGM5 protein (ab160436)
Key features and details
- Expression system: Wheat germ
- Tags: GST tag N-Terminus
- Suitable for: WB, ELISA
Description
-
Product name
Recombinant Human Transglutaminase 5/TGM5 protein -
Expression system
Wheat germ -
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
FKLLDPPNMGQDICFVLLALNMSSQFKDLKVNLSAQSLLHDGSPLSPFWQ DTAFITLSPKEAKTYPCKISYSQYSQYLSTDKLIRISALGEEKSSPEKIL -
Amino acids
511 to 610 -
Tags
GST tag N-Terminus
-
Specifications
Our Abpromise guarantee covers the use of ab160436 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Western blot
ELISA
-
Form
Liquid -
Additional notes
This product was previously labelled as Transglutaminase 5.
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
pH: 8.00
Constituents: 0.31% Glutathione, 0.79% Tris HCl
General Info
-
Alternative names
- Protein glutamine gamma glutamyltransferase 5
- Protein-glutamine gamma-glutamyltransferase 5
- PSS2
see all -
Function
Catalyzes the cross-linking of proteins and the conjugation of polyamines to proteins. Contributes to the formation of the cornified cell envelope of keratinocytes. -
Tissue specificity
Expressed in foreskin keratinocytes. -
Involvement in disease
Defects in TGM5 are a cause of peeling skin syndrome type A (APSS) [MIM:609796]. A non-inflammatory form of peeling skin syndrome, a genodermatosis characterized by the continuous shedding of the outer layers of the epidermis. In APSS patients, skin peeling is strictly limited to the dorsa of the hands and feet, and it is accompanied by accompanied by painless erythema and spontaneous non-scarring healing. Ultrastructural and histological analysis shows a level of blistering high in the epidermis at the stratum granulosum-stratum corneum junction. -
Sequence similarities
Belongs to the transglutaminase superfamily. Transglutaminase family. -
Cellular localization
Cytoplasm. Associated with intermediate filaments. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab160436 has not yet been referenced specifically in any publications.