Recombinant Human Transglutaminase 5 protein (ab160436)
- Datasheet
- References
- Protocols
Overview
-
Product nameRecombinant Human Transglutaminase 5 protein
-
Protein lengthProtein fragment
Description
-
NatureRecombinant
-
SourceWheat germ
-
Amino Acid Sequence
-
SpeciesHuman
-
SequenceFKLLDPPNMGQDICFVLLALNMSSQFKDLKVNLSAQSLLHDGSPLSPFWQ DTAFITLSPKEAKTYPCKISYSQYSQYLSTDKLIRISALGEEKSSPEKIL
-
Amino acids511 to 610
-
Tagsproprietary tag N-Terminus
-
Specifications
Our Abpromise guarantee covers the use of ab160436 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Western blot
ELISA
-
FormLiquid
-
Additional notesProtein concentration is above or equal to 0.05 mg/ml.
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
pH: 8.00
Constituents: 0.31% Glutathione, 0.79% Tris HCl
General Info
-
Alternative names
- Protein glutamine gamma glutamyltransferase 5
- Protein-glutamine gamma-glutamyltransferase 5
- PSS2
see all -
FunctionCatalyzes the cross-linking of proteins and the conjugation of polyamines to proteins. Contributes to the formation of the cornified cell envelope of keratinocytes.
-
Tissue specificityExpressed in foreskin keratinocytes.
-
Involvement in diseaseDefects in TGM5 are a cause of peeling skin syndrome type A (APSS) [MIM:609796]. A non-inflammatory form of peeling skin syndrome, a genodermatosis characterized by the continuous shedding of the outer layers of the epidermis. In APSS patients, skin peeling is strictly limited to the dorsa of the hands and feet, and it is accompanied by accompanied by painless erythema and spontaneous non-scarring healing. Ultrastructural and histological analysis shows a level of blistering high in the epidermis at the stratum granulosum-stratum corneum junction.
-
Sequence similaritiesBelongs to the transglutaminase superfamily. Transglutaminase family.
-
Cellular localizationCytoplasm. Associated with intermediate filaments.
- Information by UniProt
Images
Datasheets and documents
References
ab160436 has not yet been referenced specifically in any publications.