Overview

  • Product name
    Recombinant Human Transglutaminase 5 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      FKLLDPPNMGQDICFVLLALNMSSQFKDLKVNLSAQSLLHDGSPLSPFWQ DTAFITLSPKEAKTYPCKISYSQYSQYLSTDKLIRISALGEEKSSPEKIL
    • Amino acids
      511 to 610
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160436 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Protein glutamine gamma glutamyltransferase 5
    • Protein-glutamine gamma-glutamyltransferase 5
    • PSS2
    • TG(X)
    • TGase 5
    • TGase X
    • TGase-5
    • TGase5
    • TGASEX
    • Tgm5
    • TGM5_HUMAN
    • TGM6
    • TGMX
    • TGX
    • Transglutaminase X
    • Transglutaminase-5
    see all
  • Function
    Catalyzes the cross-linking of proteins and the conjugation of polyamines to proteins. Contributes to the formation of the cornified cell envelope of keratinocytes.
  • Tissue specificity
    Expressed in foreskin keratinocytes.
  • Involvement in disease
    Defects in TGM5 are a cause of peeling skin syndrome type A (APSS) [MIM:609796]. A non-inflammatory form of peeling skin syndrome, a genodermatosis characterized by the continuous shedding of the outer layers of the epidermis. In APSS patients, skin peeling is strictly limited to the dorsa of the hands and feet, and it is accompanied by accompanied by painless erythema and spontaneous non-scarring healing. Ultrastructural and histological analysis shows a level of blistering high in the epidermis at the stratum granulosum-stratum corneum junction.
  • Sequence similarities
    Belongs to the transglutaminase superfamily. Transglutaminase family.
  • Cellular localization
    Cytoplasm. Associated with intermediate filaments.
  • Information by UniProt

Images

  • ab160436 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160436 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160436.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up