Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MKVVNLKQAILQAWKERWSDYQWAINMKKFFPKGATWDILNLADALLEQA MIGPSPNPLILSYLKYAISSQMVSYSSVLTAISKFDDFSRDLCVQALLDI MDMFCDRLSC
    • Amino acids
      1 to 110
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160688 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CRSP complex subunit 4
    • Activator recruited cofactor 100 kDa component
    • Activator-recruited cofactor 100 kDa component
    • ARC100
    • Cofactor required for Sp1 transcriptional activation subunit 4
    • CRSP complex subunit 4
    • CRSP100
    • CRSP4
    • DRIP100
    • hTRAP100
    • KIAA0130
    • MED 24
    • MED24
    • MED24_HUMAN
    • Mediator complex subunit 24
    • Mediator of RNA polymerase II transcription subunit 24
    • Mediator of RNA polymerase II transcription subunit 24 homolog
    • MGC8748
    • OTTHUMP00000164458
    • OTTHUMP00000164460
    • THRAP4
    • Thyroid hormone receptor associated protein 4
    • Thyroid hormone receptor associated protein complex 100 kDa component
    • Thyroid hormone receptor-associated protein 4
    • Thyroid hormone receptor-associated protein complex 100 kDa component
    • Trap100
    • Trapp100
    • Vitamin D3 receptor interacting protein complex component DRIP100
    • Vitamin D3 receptor-interacting protein complex 100 kDa component
    see all
  • Function
    Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.
  • Tissue specificity
    Ubiquitous. Abundant in skeletal muscle, heart and placenta.
  • Sequence similarities
    Belongs to the Mediator complex subunit 24 family.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab160688 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160688 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160688.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up