Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSGVRAVRISIESACEKQVHEVGLDGTETYLPPLSMSQNLARLAQRIDFS QGSGSEEEEAAGTEGDAQDWPGAGSSADQDDEEGVVKFQPSLWPWDSVRN NLRSALTEMCVLYDVLSIVRDKKFMTLDPVSQDALPPKQNPQTLQLISKK KSLAGAAQILLKGAERLTKSVTENQENKLQRDFNSELLRLRQHWKLRKVG DKILGDLSYRSAGSLFPHHGTFEVIKNTDLDLDKKIPEDYCPLDVQIPSD LEGSAYIKVSIQKQAPDIGDLGTVNLFKRPLPKSKPGSPHWQTKLEAAQN VLLCKEIFAQLSREAVQIKSQVPHIVVKNQIISQPFPSLQLSISLCHSSN DKKSQKFATEKQCPEDHLYVLEHNLHLLIREFHKQTLSSIMMPHPASAPF GHKRMRLSGPQAFDKNEINSLQSSEGLLEKIIKQAKHIFLRSRAAATIDS LASRIEDPQIQAHWSNINDVYESSVKVLITSQGYEQICKSIQLQLNIGVE QIRVVHRDGRVITLSYQEQELQDFLLSQMSQHQVHAVQQLAKVMGWQVLS FSNHVGLGPIESIGNASAITVASPSGDYAISVRNGPESGSKIMVQFPRNQ CKDLPKSDVLQDNKWSHLRGPFKEVQWNKMEGRNFVYKMELLMSALSPCL L
    • Amino acids
      1 to 651
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160487 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 77-KD subunit
    • Activator recruited cofactor 77 kDa component
    • Activator-recruited cofactor 77 kDa component
    • ARC77
    • Cofactor required for Sp1 transcriptional activation subunit 6
    • cofactor required for Sp1 transcriptional activation, subunit 6, 77kDa
    • CRSP complex subunit 6
    • CRSP6
    • CRSP77
    • DRIP80
    • med17
    • MED17_HUMAN
    • Mediator complex subunit 17
    • Mediator of RNA polymerase II transcription subunit 17
    • Mediator of RNA polymerase II transcription subunit 17, S cerevisiae, homolog of
    • Thyroid hormone receptor-associated protein complex 80 kDa component
    • Thyroid hormone receptor-associated protein, 80-KD subunit
    • Transcriptional coactivator CRSP77
    • Trap80
    • VITAMIN D RECEPTOR-INTERACTING PROTEIN, 80-KD
    • Vitamin D3 receptor-interacting protein complex 80 kDa component
    see all
  • Function
    Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.
  • Tissue specificity
    Ubiquitous.
  • Involvement in disease
    Defects in MED17 are the cause of microcephaly postnatal progressive with seizures and brain atrophy (MCPHSBA) [MIM:613668]. It is a disorder characterized by postnatal progressive microcephaly and severe developmental retardation associated with cerebral and cerebellar atrophy. Infants manifest swallowing difficulties leading to failure to thrive, jitteriness, poor visual fixation, truncal arching, seizures. There is no acquisition of developmental milestones and patients suffer from marked spasticity and profound retardation. Progressive microcephaly becomes evident few months after birth.
  • Sequence similarities
    Belongs to the Mediator complex subunit 17 family.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab160487 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160487 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160487.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up