Description

  • Product name

    Recombinant Human TRAPPC2 protein
  • Purity

    > 90 % SDS-PAGE.
    ab136702 is purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMSGSFYFVIVGHHDNPVFEMEFLPAGK AESKDDHRHLNQFIAHAALDLVDENMWLSNNMYLKTVDKFNEWFVSAFVT AGHMRFIMLHDIRQEDGIKNFFTDVYDLYIKFSMNPFYEPNSPIRSSAFD RKVQFLGKKHLLS
    • Predicted molecular weight

      19 kDa including tags
    • Amino acids

      1 to 140
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab136702 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.02% DTT, 0.32% Tris HCl, 40% Glycerol, 1.17% Sodium chloride

General Info

  • Alternative names

    • hYP38334
    • MBP 1 interacting protein 2A
    • MBP-1-interacting protein 2A
    • MIP 2A
    • MIP-2A
    • MIP2A
    • SEDL
    • Sedlin
    • SEDLP
    • SEDT
    • Spondyloepiphyseal dysplasia tarda protein
    • Spondyloepiphyseal dysplasia, late
    • TPPC2_HUMAN
    • Trafficking protein particle complex 2
    • Trafficking protein particle complex subunit 2
    • TRAPPC2P1
    • TRS20
    • ZNF547L
    see all
  • Relevance

    Function: Prevents MBP1-mediated transcriptional repression and antagonizes MBP1-mediated cell death. May play a role in vesicular transport from endoplasmic reticulum to Golgi. Tissue specificity: Widely expressed. Disease: Defects in TRAPPC2 are the cause of spondyloepiphyseal dysplasia tarda (SEDT) [MIM:313400]. SEDT is an X-linked recessive disorder of endochondral bone formation. Similarity: Belongs to the TRAPP small subunits family. Sedlin subfamily.
  • Cellular localization

    Cytoplasm > perinuclear region. Endoplasmic reticulum. Golgi apparatus. Localized in perinuclear granular structures.

Images

  • 15% SDS-PAGE analysis of 3 µg ab136702.

References

ab136702 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab136702.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up